SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0073752 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0073752
Domain Number 1 Region: 78-140
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000215
Family RING finger domain, C3HC4 0.02
Further Details:      
 
Domain Number 2 Region: 8-31
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000994
Family CCCH zinc finger 0.0057
Further Details:      
 
Weak hits

Sequence:  FBpp0073752
Domain Number - Region: 169-192
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00733
Family CCCH zinc finger 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0073752   Gene: FBgn0030577   Transcript: FBtr0073935
Sequence length 210
Comment pep:known chromosome:BDGP5:X:14669392:14670151:1 gene:FBgn0030577 transcript:FBtr0073935 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSSRQNLHKICRYRLRGNCRFDDLCRYSHDVLQNDNLRPQISNNADEVVGHANRYSRPM
TGANATEEMKLSFAIAKSQDKMCGICLETVVKKRGRECRFGILPKCKHIFCLTCIRRWRQ
AEYIEDNVKRGCPECRVFSEFVCPSAYWVDTKEEKDKLLSEYRAAMGAKDCKYFNGGLGK
CPFGTNCFYNHRSLAGDNRIQRHSMEDDDF
Download sequence
Identical sequences Q9VY21
NP_572969.1.81976 7227.FBpp0073752 FBpp0073752 FBpp0073752 FBpp0073752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]