SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0073776 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0073776
Domain Number 1 Region: 162-242
Classification Level Classification E-value
Superfamily L domain-like 0.0000000287
Family Ngr ectodomain-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0073776   Gene: FBgn0030603   Transcript: FBtr0073959
Sequence length 463
Comment pep:known chromosome:BDGP5:X:14941529:14945533:1 gene:FBgn0030603 transcript:FBtr0073959 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRNIRNLKDPTTWTRILLPFLSCLLLAVQADLVNVTCGEYGNTITCDCNNSDQTMALPSL
RGNVYMIEIRNCRDLLVEANRLANTMGLHKVVFRQVGQLVLREHALSVPRYASNKALIVE
FEQTNLKLIESHAINGNIEEISFVGGRIELMKPFGFTTTKDSAILLKLDGVTIQRIESQA
FKKFAVEQMSIANCQFLGDLPTRAFYELEVTNELSLRGNQFQEVHSHAFSFKLVSKLSLS
DNHFLSVDGEWLEAQIRDAATIRGNEFGATSEIAFRSLTVHRSYQLSERLELRFHNNSLR
SSRPGADPRVDGTAENVAPQPLQFDNSFALNVRDIRYNNAWSCEQLDRNVEPPLPRAEFF
RLHSDQLMFHPPDFGGQGQIQPYIPLRSLITDECRERSYMAFIISGSVLLGLLLLLLILL
LWWRVVQKRRRRKLDVVQPEPRTYKETQIVYQIENAGLLKTDL
Download sequence
Identical sequences Q9VXZ2
7227.FBpp0073775 FBpp0073775 FBpp0073776 FBpp0073775 FBpp0073776 NP_996437.1.81976 NP_996438.1.81976 FBpp0073775

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]