SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0073787 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0073787
Domain Number 1 Region: 587-789,954-1059
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 6.21e-55
Family Regulator of chromosome condensation RCC1 0.02
Further Details:      
 
Domain Number 2 Region: 4147-4350
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.4e-24
Family APC10-like 0.012
Further Details:      
 
Domain Number 3 Region: 4984-5048
Classification Level Classification E-value
Superfamily RING/U-box 0.000000274
Family RING finger domain, C3HC4 0.013
Further Details:      
 
Domain Number 4 Region: 2818-2863,2947-2992
Classification Level Classification E-value
Superfamily E set domains 0.00000867
Family Filamin repeat (rod domain) 0.014
Further Details:      
 
Weak hits

Sequence:  FBpp0073787
Domain Number - Region: 3906-3943
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0115
Family beta-sandwich domain of Sec23/24 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0073787   Gene: FBgn0030600   Transcript: FBtr0073970
Sequence length 5233
Comment pep:known chromosome:BDGP5:X:14904716:14957440:-1 gene:FBgn0030600 transcript:FBtr0073970 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVGLLNPLKYGDHFYELYTNSTRRKMQHDRKVLTKRKSRKDKSAAAMAAAAAAAVLEGNA
GAGGLVNPLDPPLVKEQLMILPSFPVAHIELDPNASKFAVFSAIRSTVLEAETRYSLFQE
GGAPSGQSGSNQKKWSNNVNSACCMMCAHSCMISNLLDCSCHAHMAMHGAVGPGNAGPGG
PVGVLVDGRIPAPVPVVVGGPGLPAEKRPRRDSANSDADSDTEEPTEREPVYATVPLIVG
AGLRSLFELIADARHVHPLLCTKALKALLDVIQGQQPESFKLEPEELINPLYDLLLDLAT
MPAALNSATGAEANWSAMACAALLGLCIARGDTGKMLKAIAAMLMTPRQLSAQIVQLPVV
LATLQHTVISAALNKPTRPDFHSHGVPHNSLIDEFPVKLPPLSTGAPITSPAMACDGVFV
YLLYGGTLLKIGTGFGGSYKGHIYAQNEDFSHERSAWLGYSGGQLYFRRTCRRSAGDQLQ
MVGLDTLAIKAMSPLSMLHMREGLNYVLFTDDDSLHAICSNRDDTLVVKKLNLYHNSYNI
DPPPFELPLQLARKKFRTLGYAAFEDELLNQYQIQRIQSAHNSFEPKLPAPCRDADVDVM
GMACGKEFGLVRASNGRVYYYGKSAALGLKCVGRTPTLKLTELVISKAANIVHVAVGHDG
IHALLVNDDGTVFFAGTARRGEDGDSSKNRRQPKAVKPKKMTKIDGHVVVHAACNNGTSA
FVTKTGKLIMYGKDTAHCDAMGFVSELLEQHVTKVALGKAHCVALNAKGQLFSFGLNNKG
QCGRIFNKLQPVKDVPPFASSSTAAACFASLLPLDKRLKLDFSTLCDYDDHNLVQGQCRV
CVICRECTGYNVSCVSALNVPLDQRLAGSICPCGHGDAGCAKCGLCAACIALQDSDEAKT
ELKPPPSDVQQRQQRSKTLIMRRKERKGELETGAAGGGAATPTDLDKDPPRVAPLAPQLL
QLTSSSPVVQVACGLHHTVVLTLAGEVYTFGSNQYGQLGSGDLQPVSGPVRVQVPGAISQ
VAAGSNHTVLLTSKGMVYTFGNYQKGQLGRLPSDYGLKPPPQDDDSPVGAGSDGGAGGSP
TVAPVGMPGPERSQSPANVQPSGSKEMPPLLPVLTQRQKFLWNCSPGAVFGLGPCYGKKV
TWIGANGDQTFIKIDESLITAQMLPKMHVVANKKTILLIPSIPLSFHTLSINRRDGSCTA
HYRGQTNFVKLMQAQPEQQQPEINSNLDVAVTPVADSPAHASTSSLLAALTGTATAGVPI
NEQMSRSMHEARNQIFEEQLPEVGSSAAAAAVAAPGTPVSAGSVPRSRRGGKQGTSSPEP
IPSPPQLAFTMDPTYNVLWVFDGAARKLRCHNVVASDINDSDANAATYRSLLSPELSLPD
RVDSRVARSQASLNLLACLDILTSAQDNIPGCFEQPLLKQTQQTAETQAGEFQVVNRFDN
FGGGWGYSGHSVEAIRFSADTDIVICGFGMFGGRGEYSCKLKLFDLGGDGGGYEKEGILI
SETKEVPYECGARSKHHILLPKPVSAVAGRWYLVWARIAGPSSDCGSCGQASVTTEDQVV
FSFKSSKKANNGTDVNSGQIPAILYRLVTQDCKQTPAQMDADPVQRISRAFANSVSRECF
ESLVVLLSWSWDCFKLQLREERDRSRPLQLQQSLQYLGYVIKSCLRLLRKYTIEIYPQRN
SSTSVATGGGSNAAHGSGVVTTAKSVQSKPNKDKNTPRVVGNAGVMAKYFGDPSTSVAPA
MISSASSGGAPSTSASAAVAPGSGTPVTRKTNMENIQLAECIGNVRALLIGIFCDDIFKD
IATDEGYELSLEILDECHLSFVACFDAFYPTSSLKWNCLCDLLAQMDRGALHSRLLSAIL
AGLCSPSVKLRATFSLLSAAGNERQSIISPSDNSGLPMLSSTDAHPYPVLVEQMIYRTQQ
EKSDFLSNSWTFKDVLVRLLDIIASPIRSRIEAIYSRSLGSLGYPGGKDCVNQGLIDNCC
HLLARVLAEIVYQTAMGEYDKLFMPPRTLHSTGARFARCDVSRTWNTGNFGPDAIAFAVD
RPGVAIAGAMVYSGSGSYDYQLELLYDNTADLQPQHKWETLESVSGSYDQDAVHNDLAEI
KFDHPVHIKENARYALRLCSQGARTCSGDAGMPAVRGPCGAQFHFYACDLSFNGTTPARG
QLPCILYYSTPMKQDGHSASGRTGDGSNVATHLEDRIMLLGPHEVSTRDTALQIAADITK
KCTELLILARNAMAASCSPSDNSSNHTQTIDSEHNITPIEEHMDINWANNSRTAALPTAI
DPQLSTARDLGKRIESFSKGLMETLKFDKRSTNPFEMEIEIGATEVEESADLRNGQSQSV
SQSQSQSQSVPINGNERTADFEFAEQSAQQSMPQHLHSDSEEAPLEVAGMAAGGGVSVAD
GSGGVAGVGSQAAAVQLLEVFNLAASNMFHTLLPLVYAHIANLACSDPKSSVQILGLIKE
ILPHIAALNQLHVSKDQRQPEPAIFATQTSGSGNSNSSSTTSNHYCVVESDHPYKSASIS
SYRVEFPPCVQWLTIEFDPQCGTAQLEDYLLLSIPMRPASQAPPVPHVDDYLEQADNNVN
GAGDRRRNTGGGIAGSGAAPNTHQRSASVQLTMASCCRSPGCGNAPGSAAAPSSMPLRSQ
DPNDREWIVVKKFNTASTWLHNVLILPGNCVEFSLETASLYAQDPHNNRYGFKCLVVGYD
NPTSINASNSCLIRLEQELAYLGGMCSANLMKKELNLPDDKDVEDMSGIEETINTHHTLL
SKGFALSEPQLTVHQALESYLPIGSQSNERQFLKDFISGAPGSSGARLAAWLQPESRLDP
NKCELNTITEPLRYGWPSQVTVTIRDQYGDAVLVPELKVEIKAIPTGSGPNGSATGTGTS
CTSVAEVSAPGPNLWMRRASRDTWGWGGMAPPPRINYEPTVKDKMVFKAITFMKPYANYS
FEELRYASPVQTRVTELLNAKDMEDGTFSVQWTPSSVGAYCLAVTIDGIPLEEVYRVDVK
EGILPPPTQRNSAQRRPQAPSKLRRFQARHSSGLRIRSHPTLQSEQVGVVRVGGVISFID
EIENDDGVWLRLSTESIRQHCTMGWYPTEAWCLQFNQHLARMLLQPVTDKEVNPVRKGVG
AEEDVEEQPPVTPSASGEASPEPEPDPSPVLSPAKTKPGRFLSGHQSTNPFLYPAKHADL
AEREAQVQEEREKEEEQVDDEDADDREPEQEALPAVELLPAHIGSAIAGVVGGGAIKLQA
LQKWFKGDAVDGPQPLTPSHSPPLAGVSVRELVRAMGGQDSPRGNGNRSQQEQDPEFSLA
SMRRPNYSASQTAALLSTPKHTPKRSAVVASETSGLEDELSLLQITTTTTGQGEQQSELQ
LATTSTASSASKRNPMGPIKRAMPPSFAESIRAVFAALLWHEGVVHDAMACASFLKFHPG
LPKEGATVVTRRGESGDPRLQLSREQKAQQRHSVEVANAGNYLNIRPSTLETLTKSGNCS
LHNRSKYRKNLLSGGGGAINSGDDTAQKLQALPEMVSVLPPALRCLVYLWEQICSGCVQI
VQSNALEQREPRLLSPGSRDLNGDADTEGKEGKNSDQASAGEKDLGRKCKRKKKDDGSWC
EICELFLPMPVTYHMRIAHPGCGKSAKGKGYNSVGIFCEGWAGNCGEGGKGASSWFLMCD
PCRDRYLASCRSANNINSAARQLESSAAEGNELNLFGVKSTTLIANAEVYTTMRENATFL
LELCSSSSSASGAAGSLAATSSSSKRSPQQMSVVAMPVVIEHQLGNSDLKPSTSRCSRMA
RLSGSKFCPGVGSGAFRKSFVGGPPTAPENVWLAPESFACLECLGTAGHEDLPYEMFGLG
PNSNDNGYDRPLSEISYESCEPNNYDMLSGSLAPGTTAAASVGGGNLSKFHRSYSMGQGW
ASLAQHNHPPPHHPQQQHHQQQQMNLQLQQHQAPPVDGQPKVVYRRRNNSTSEGDGSLLI
CYPSEHLRRLVPQKLLASVSVMQTASGEGTGKDHATGTLGLDQSAGQNGGGNLLLTRPAM
AFITQKHELDRLRAAMRRSLRIAACRIYALQALNWLLRSVTQGVCLHDLMWWFVSSLNPT
GGHQPVERGEEASEPALEHPVAYTQISGRFAHLITQSLHVFLQSVADLTLHLPLGSPLQR
VAIQCFGIRFRQADHQFLHSSHVFGNISKILSKSDEQNDAMAVSTILKPDCDVEHNQVHS
VATGGSSGAGARLLCYTDLAGMFEVTVSSRPAMAESLTDNSTETFWESDEEDRNKCKIIE
LSLTKLNYACRYLLVHIDNSRDIQNKVLNVVFYAGQSLGDTNIIKSADVDPKACSWISAK
ICDDSCTHFRLELHGPENTLRVRQIKLLGLPIGGAVGSDDSSDHKHQPHLRLSHASRIQQ
QICEAETLRVFRLITGQVFGKLISNVSSDLVPPDSAGIGPPSGGAASTSLLADSLDLREH
MVGILFSRSKLSHLQKQVIVHIVHAIRKEAQRAKEDWELANLAHVLKQSPQQQTAPALAA
SASCESTPERSRAPDTYCFEMLSMVLALSGSVVGRSYLSQQHGLLRDLLGLLHTGSDRVQ
RQVTALLRRILPEITPESFAELLGVQRLPPADYSIAHQSASDFDMSRLGLLDIFLAVIAK
SLQLQVKVKTTVASTGPSGSGGVSGSSSGNGGAVLKAGQQEKTPAFVRLWSSLDLSVQQL
RSRPPTGEPGTTDPFQFDALPPRKESKRNLNQRWFLNGVISTKQAESIISLIRDLASGKL
SEKWSQITKAAIAESVLNLTRLEEIYRSPEHCTKTSTLWLALASLCVLERDHVEKLSSGQ
WSKLCDTRPLCSNHDDGETAAIIQCETCGSLCGDCDRFLHLNRKTRSHKRTVCKEEEEAI
RVELHESCGRTKLFWLLALADSKTLKAMVEFRDGSHTIISGPQEAVGRCRFCGLTGNSGL
LEIGNVCADAQCQEYAANSCLKTKPCGHACGGVTGERKCLPCLQHVCHTRENELAEELRD
PKLTQDADDMCMICFVEALSCAPSIHLECGHVFHYHCCKAVLEKRWSGPRITFGFSLCPI
CKADIQHPLLSDILEPINGLKQDVKRKALMRIKYEGVVKDTDSKNVNMTQLAMDRYAYYV
CFKCQKAYYGGEARCDAEIGEKFDPEELVCGGCSDVARAQMCPKHGTDFLEYKCRYCCSV
AVFFCFGTTHFCDTCHDDFQRLTNIPKVKLPQCPAGPKAKQLLGDECPLHVMHPPTGEEF
ALGCGVCRNAQTF
Download sequence
Identical sequences Q9NB71 X2JF19
7227.FBpp0073787 FBpp0073787 FBpp0073787 FBpp0073787 NP_001285258.1.81976 NP_511159.3.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]