SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0073824 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0073824
Domain Number 1 Region: 43-169
Classification Level Classification E-value
Superfamily EF-hand 9.52e-24
Family EF-hand modules in multidomain proteins 0.0041
Further Details:      
 
Domain Number 2 Region: 261-339
Classification Level Classification E-value
Superfamily RING/U-box 4.83e-16
Family ZZ domain 0.022
Further Details:      
 
Weak hits

Sequence:  FBpp0073824
Domain Number - Region: 181-232
Classification Level Classification E-value
Superfamily EF-hand 0.0871
Family EF-hand modules in multidomain proteins 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0073824   Gene: FBgn0015926   Transcript: FBtr0074007
Sequence length 649
Comment pep:known chromosome:BDGP5:X:15222379:15225035:1 gene:FBgn0015926 transcript:FBtr0074007 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRSSVPVQLTKLRNSAEAVASIAREKGSQGGQGQKQQVDKELSTIMDDLQRDYGNYKYT
VYRCASKFVALQKIFHTGKIPYKLVLAILDRHNLSGGLELMVPPFQLTSLLHDVYFACEK
LGHFNQDANYKLDRATGLLANFFWNVYDPQRRHSISLLEIRITFILLCKLYSSDHLVGDI
FGLLADPKSQIISRYAFEQLLATLSKLLSYLGEAKAYGVHNLPLAMEQCFARCPHGVGGL
TEPQFHKLWTGAGVQTRFLIYGNLLALVKRIEDTEHLIHSNSCAGCRKEHIVGIRFRCQV
CRDISLCLPCFAVGFAGGRHEPGHRMCEVFVEDQPPLRWTRHLARLCGWLVMPRKTQEEE
RRGFCNAQESGPALGQSAATPIPAETRSVRSQCQEKDRTVVLQQQQQELCSLTGLASEAS
SRLQSIIDRLLLQNAKLETQLQTVATASSSEISQFLSAHQCFLLQIIEDMRQLSHASAVT
SPPPAPAAQVAPSAAPLVSSTFLSSSTPQRQMLFDMYAPVGANLTHSINGADLNRSYLEA
NKSDYSLNDISLWFDQRRSSVQPGQGPGSLPAPLPLPMPLGALLEQQPANGGDGRDTEMV
NFKLLLHKVKEIVEDSYSDNAELSAATQNLENVLDSIIKSEEQQRRIST
Download sequence
Identical sequences Q24175
FBpp0073824 FBpp0073824 FBpp0073824 NP_511162.1.81976 7227.FBpp0073824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]