SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0073843 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0073843
Domain Number 1 Region: 89-237
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.7e-31
Family Fucose binding lectin 0.0013
Further Details:      
 
Domain Number 2 Region: 203-380
Classification Level Classification E-value
Superfamily C-type lectin-like 1.7e-28
Family C-type lectin domain 0.00081
Further Details:      
 
Domain Number 3 Region: 380-449
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000167
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 4 Region: 433-497
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000208
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 5 Region: 493-557
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000528
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 6 Region: 37-92
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000264
Family Complement control module/SCR domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0073843   Gene: FBgn0030617   Transcript: FBtr0074026
Sequence length 955
Comment pep:known chromosome:BDGP5:X:15033962:15057255:-1 gene:FBgn0030617 transcript:FBtr0074026 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHRTQPSLPLPLPLLALALALASALAFAQAQNIDAGCSFPGSPAHSSVVFSNANLTQGTV
ASYSCERGFELLGPARRVCDKGQWVPEGIPFCVLNVAAGKAPMQISTDGAGAPQKAIDGS
TSAFFTPETCSLTKAERSPWWYVNLLEPYMVQLVRLDFGKSCCGNKPATIVVRVGNNRPD
LGTNPICNRFTGLLEAGQPLFLPCNPPMPGAFVSVHLENSTPNPLSICEAFVYTDQALPI
ERCPTFRDQPPGALASYNGKCYIFYNRQPLNFLDALSFCRSRGGTLISESNPALQGFISW
ELWRRHRSDVSSQYWMGAVRDGSDRSSWKWVNGDELTVSFWSHPGGDEDCARFDGSKGWL
WSDTNCNTLLNFICQHQPKTCGRPEQPPNSTMVALNGFEVGAQIKYSCDANHLLVGPATR
TCLETGFYNEFPPVCKYIECGLPASIAHGSYALLNNTVGYLSLVKYSCEEGYEMIGRALL
TCDFDERWNGPPPRCEIVECDTLPGNYYSTIINAPNGTYYGSKAEISCPPGYRMEGPRVL
TCLASGQWSSALPRCIKLEPSTQPTAASTIPVPSSVATPPPFRPKVVSSTTSRTPYRPAV
STASSGIGGSSTSTVGTYPSLSPTQVEINGESESEEEINVPPVPGTVREEFPPRRTVRPV
LIPKKPNSTPAALPPTTHQVPPQPPSTYAPTPPRSSRPSGAPNSAGEVETTTRNTQQIIA
NSHPQDNEIPDSVNIQQNQSPNVNVPFAVDNPDRKETKEAKLNLGAIVALGAFGGFVFLA
AVITTIVILVRRNRTTQHYRHRASPDCNTVASFDSSTSGSRNGLNRYYRQAWENLHESAS
KNSSHNALRRKETLDPPSMTRSRDNLRDNMQRSRENLDRCGRDNYGMRDDSEMVVSSVVS
DVCLKGEKKRHHHHHHKSSSRNGDYRDRDHSSGRREHHRHSGGGGGGGGGGGGHY
Download sequence
Identical sequences Q9VXX7
NP_573006.1.81976 FBpp0073843 FBpp0073843

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]