SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0073912 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0073912
Domain Number 1 Region: 286-339
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 2.84e-16
Family B-box zinc-binding domain 0.00059
Further Details:      
 
Domain Number 2 Region: 2-63
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000000863
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0025
Further Details:      
 
Weak hits

Sequence:  FBpp0073912
Domain Number - Region: 118-222
Classification Level Classification E-value
Superfamily t-snare proteins 0.0188
Family t-snare proteins 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0073912   Gene: FBgn0030694   Transcript: FBtr0074097
Sequence length 342
Comment pep:known chromosome:BDGP5:X:15693629:15694994:1 gene:FBgn0030694 transcript:FBtr0074097 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSCFGCGRKYGLFCKEYGCPNCGYSFCSKCLKRPMPVPRHAGKVHNVCLICYDKLSKLQA
SADAEKVIDCDALPGILVTKMNLAPPSKSSDGADALFNDSLPVEELPQALVPSSSSSPHS
KDHKDHIDENLDSELTKRMQDYKRVDATDDEIRTRLANLTGMPHTKSYDKKDLLLSTDQR
NDQEKMRDLLAQFVDEAQLDQNISRQRDDSISDIERRLRALRDTPVDSDACPSRSQMESI
ADNEEDDETLLQNILKKYVAESRLPEPSESEISPINTESPGNTEELPWCNICNEDADFRC
HGCGGELFCTLCYKECHDDDEEYRAHVKEKYSAPPKLKENHF
Download sequence
Identical sequences Q4QQ70
FBpp0073912 NP_001285298.1.81976 NP_573077.2.81976 7227.FBpp0073912 FBpp0073912 FBpp0073912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]