SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0073969 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0073969
Domain Number 1 Region: 124-172
Classification Level Classification E-value
Superfamily RING/U-box 1.5e-17
Family RING finger domain, C3HC4 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0073969   Gene: FBgn0052581   Transcript: FBtr0074184
Sequence length 283
Comment pep:known chromosome:BDGP5:X:15690936:15693189:-1 gene:FBgn0052581 transcript:FBtr0074184 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEPKSVSTAELPSTSTGASSSSSTLSNNVSYDKIAWTRDITEPLAEESSTSQLRPLGTS
IPTNSTASELKKSNTSYSFTGDYLSGGNKADLKGGYPFGGTDTDTKANEKDKEKEHTADD
SLYECNICLDTAKDAVVSMCGHLFCWPCLHQWLLTRPNRKLCPVCKAAVDKDKVIPLYGR
NSTHQEDPRNKVPPRPAGQRTEPDPVPGFPGFGFGDGFHMSFGIGAFPFGFITSRLNFFE
PRPPADIRRLHEDEPWALSKLFWHFVVFVIYGLLVPIVHGSSR
Download sequence
Identical sequences Q8IR26
7227.FBpp0073969 FBpp0073969 FBpp0112351 FBpp0073969 NP_001096988.2.81976 NP_727898.2.81976 FBpp0073969 FBpp0112351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]