SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0074189 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0074189
Domain Number 1 Region: 235-298
Classification Level Classification E-value
Superfamily ClpS-like 0.0000000000000115
Family Adaptor protein ClpS (YljA) 0.036
Further Details:      
 
Domain Number 2 Region: 793-881
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000422
Family PF0610-like 0.067
Further Details:      
 
Weak hits

Sequence:  FBpp0074189
Domain Number - Region: 1169-1222
Classification Level Classification E-value
Superfamily RING/U-box 0.00812
Family RING finger domain, C3HC4 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0074189   Gene: FBgn0030809   Transcript: FBtr0074415
Sequence length 1824
Comment pep:known chromosome:BDGP5:X:16850978:16862682:-1 gene:FBgn0030809 transcript:FBtr0074415 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRYDMEDVVVAPPAECSSPLKEWRLKRQAGTLDRSDIIEFLKRESPKYFDYQTSATVKD
TNVITLKCMFKESLAKEEIIDVVVEFMLGDNPSSALEKLRLEGNTATVCGKVFKNGEPTY
SCRECGVDPTCVLCVNCFKRSAHRFHKYKMSTSGGGGCCDCGDDEAWKKDQYCELHLANR
KNPLESKILTDAVLERVEICFGAILAFCVSYLEIEPNASLQCLDGNVEGGQVDGAQYCTV
LYNDESHTFDQVIQTLTKIAKCRAKDAMEIVAAIDREGRAVVKCDTFEECNKLKVSIENQ
MILPTSLVSTARNNQSLRTSVLHIGAVACQQFALQLLGWFQEFLVRHYLFRKTFSELVQR
KQETFCIRHILEYDVKLWKTARTCWHRLLISGMLMEYDNKMILAQEFSRRYATIVEDFIS
DDHDHAFSIVSLSVQLFTVPSIAHHLIAHEGIFDKLLHTFYHVAIEKFIRNKTLHFSKNI
ASLTFFKRANYILYDLRYLLSLKPDVLSNDLRNGFLEGCRALMRVLNVMQGMESMTRQTG
QHMDYEPEWECAFNLHIKLATTISQVIDWASGDVKLLRKLYKMTMRALVSNSFIVGGEKV
MQPKKVADHVANCLVYDISVQPVSIHLPLSRFFAGIYLHLGAHDLTYDGLQTETEALSIK
LTPREIIEPVLCTQAMIAQVGAGLWRRNGYTLLHQLYFYRNVRCRVEMLDRDIACLQIGA
SLMESNEFLIHVLNRFNTIPWLQENYWSLLSGNEMNDDIIREASIFDEFLELLIVIIGER
WMPGVSMVTEEDRLRKEIIQLLCIKPYSHSELSRALPDGNSGNSDNVFEEVINTVAVFKK
PVGADSKGVYELKEHLLKEFNMYFYHYTKEDKSKAEELQRERRKAKKQLVCCPPPMLPKL
TPAFTPMANILQCPVFLNICSLIMERALNAYSRSFTESHLQKVLHLLGYAIQEELSEHYP
FLSFYERSQEYGILEKLEELARCPRLEAHYDFVLWTIERFKQLQAKQAPSDGRAGPSCSQ
QGTGGKLSLSAEEQAREERENRARLAAERRAHIMAQMQKAQKSFISSNAEMFADTENETR
KESASTGPMDWEDIPPEEEQGAVALESKVACLGPDRKFYHGTDDTFKCILCFENCAISRG
GRQLVSSAFVQTSRVIFTTPNLRNSQSALHISCCGHVMHYSCWLEYFTNEEFKELRRPHR
NRAALAQAANVEFQCPYCRTLSNAIIPVTETLPAFSAPPSPNESYLPLDSFVEIMSTLAI
ELGNVKDHELTTLPSVSNILRLSGVVGGLAQFERSVQLIKNPPRLHADYIEGIEFLKKAL
LNTMKIQQSHLKDHPAIESIEMVPILWDSCSYTLQALEIYLYAVEKPLKAELSMRHQSCA
RNLVRACSRSSALEWETDLPLLPPMRSQAEFSSRLLDTIFNQNDTSVLEWDCFRVLVPFQ
FGVLNLMVPEKGYKTIIPSGSMFDFYIMQTMFLAQLTKAVLCFDVEKEKAKRAEKAPNSE
LTQLDYIEQLPSRIRDNMIDFYRRYNIPARVLQKTKQKQLVEEESEENQGHGQTVVIPCE
SHHLALLLEYVQRQMSSFLRCSCLFYRFLTDVDFPDTFPTDQPDRFDLMCQYLGLDPMLG
VYFDMETVYATMMHSFASHPHIDREVEQRCQPDARRSLQVEPCLRPLPRLKVLCDDFSDL
INSVSDIFCPNNEREEMKTPTMCLICGLILCGQSYCCQPELGKVSVGACTHHAHACGAEV
GIFLRIRDCQVVYLGRGKGCFVPPPYLDEYGETDMGLRRGNPLRLSQAAYRKIYLQWLGH
GLHGEIARLNDNANVAAAAQWHHM
Download sequence
Identical sequences M9NFA7 Q9VX91
FBpp0074189 FBpp0074189 FBpp0300996 7227.FBpp0074189 NP_001245723.1.81976 NP_001285356.1.81976 NP_573184.1.81976 FBpp0074189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]