SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0074245 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0074245
Domain Number 1 Region: 194-264
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000589
Family RING finger domain, C3HC4 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0074245   Gene: FBgn0030873   Transcript: FBtr0074471
Sequence length 301
Comment pep:known chromosome:BDGP5:X:17742143:17743881:-1 gene:FBgn0030873 transcript:FBtr0074471 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPEERMRAQHQLMVEKHRGHDAMHSEMVIILFVTLVIAQIILVEWKKRHYRSYAFVTLL
AMWLIPLIISCSFGWLRFIIIWLVFTCITALVMRRAISKPIQGTTPRLVYKWFYFIYKLS
YGLGLVGYLVIIAAFLGMNYMFSQPPNTWMDVGLMFCFYGLYIGVLGRDISEICSDKMAA
AIGYYTPQGIPTRHLDQNVCAVCGNQLLVSEKEEGVIENTYKLSCNHVFHEFCIRGWCIV
GKKQTCPYCKEKVDLQKMFRNPWEKPHVLYGRLLDWIRWLVAWQPLIFFIVQGINWMLGL
E
Download sequence
Identical sequences Q8IQZ5
FBpp0074245 FBpp0074245 NP_728100.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]