SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0074330 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0074330
Domain Number 1 Region: 227-282
Classification Level Classification E-value
Superfamily RING/U-box 0.000000406
Family RING finger domain, C3HC4 0.083
Further Details:      
 
Domain Number 2 Region: 40-78
Classification Level Classification E-value
Superfamily RING/U-box 0.000000468
Family U-box 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0074330   Gene: FBgn0030915   Transcript: FBtr0074558
Sequence length 307
Comment pep:known chromosome:BDGP5:X:18274115:18275512:1 gene:FBgn0030915 transcript:FBtr0074558 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRHARNCTAGAVYTYNEKKRDAAESGYGTNAQRLGKDSVKSFDCCSLTLQPCRRPVITK
DGYLFDKEAILQYIVTKKNEYSRRLKEYERLRRAEEDKLSQEANSKQQARMERFVNAEKP
AMTPAHSSAAASEKPSTSSAAAAASSESSSASSISNMTNGHEKKLPSFWLPSECPNAGLA
KAQKPDATIYCPVSQKPLRVKDLIDVKFTLLKDGDTKRSLIAKEARYMCPITHDVLSNAV
PCAVLRPTGDVVTMECVERLIRKDMIHPLTDRKLKEKDIIPLQRGGTGYATTNDHLQAKE
KRPMLQA
Download sequence
Identical sequences A8E752 Q9VWV8
7227.FBpp0074330 FBpp0074330 FBpp0074330 FBpp0074330 NP_573288.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]