SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0074414 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0074414
Domain Number 1 Region: 156-489
Classification Level Classification E-value
Superfamily Cysteine proteinases 8.63e-63
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.00032
Further Details:      
 
Domain Number 2 Region: 36-130
Classification Level Classification E-value
Superfamily RING/U-box 1.65e-22
Family Zf-UBP 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0074414   Gene: FBgn0030969   Transcript: FBtr0074643
Sequence length 494
Comment pep:known chromosome:BDGP5:X:18752236:18754105:1 gene:FBgn0030969 transcript:FBtr0074643 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQTQAPAAKRMKLEKTPANPVEEDETPSVFNPKYRVCPYLDTINRNLLDFDFEKLCSIS
LTRINVYACLVCGKYFQGRGTNTHAYTHSVGEAHHVFLNLHTLRFYCLPDNYEIIDSSLD
DIKYVLNPTFTRQEISKLDQLQPKHSRTVDGVLYLPGVVGLNNIKANDYCNVVLHALSHV
GPLRDYFLQKQSYAHVVRPPGDSVFTLVQRFGELMRKMWNPRNFKSHVSPHEMLQAVVLW
SSKRFQITEQGDPIDFLSWFLNTLHRALKGNKHPNSSILYKIFLGEMKIYTRKMPPVELD
DAAKAQLLATEEYKDQVEDKNFIYLTCDLPPPPLFTDEFRENIIPQVNLYQLLSKFNGTA
EKEYKTYKANFMKRFEITRLPQFIILYIKRFTKNTFFLEKNPTIVNFPIKHVDFGDILGM
RQRDKDVKDTKYNLVANIVHDGDPKKGTYRAHILHKANGQWYEMQDLHVTEILPQMITLT
ESYIQIYERCPNSS
Download sequence
Identical sequences Q9VWP1
FBpp0074414 NP_573334.1.81976 FBpp0074414 7227.FBpp0074414 FBpp0074414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]