SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0074587 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0074587
Domain Number 1 Region: 139-276
Classification Level Classification E-value
Superfamily L domain-like 1.97e-26
Family Rab geranylgeranyltransferase alpha-subunit, C-terminal domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0074587   Gene: FBgn0036936   Transcript: FBtr0074818
Sequence length 402
Comment pep:known chromosome:BDGP5:3L:20099194:20100657:1 gene:FBgn0036936 transcript:FBtr0074818 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLLEAPADYLESSPDQSLQAELPILLAPPGPAALAQVRMPPPEVRLNQQNPAQQQQQRM
QFNRRQLGRRNSFDRDVAIAEEEQHLPAFVHLLPVVLPQQGPEPTLDELLRRVTQRTDLE
AVEQVRLRVISYTVSLSRLSLFLPRLQSLDLSGSVLSSLRDLGYGLLQLTRLDISNCGLN
SFDGTSGLPAIRVLIADGNMIQRVDPLAELVHLRVLKARNNRISELGLLSFLGMCPQLQE
VELQGNPVCRLPLYRSLLARSVPTLQLLDGRVLNGEPAPVEMEEATSPASSDLESGSETT
AQRPNTAPAPEPVPIALNAAIRRQVSASSGSTPVAGSVLSLVRQRRRRSGHAWVSSSSSS
GSSSASSARSTRAPSMSSCSSNSSLDVQSSSHYVFSTQSTLD
Download sequence
Identical sequences Q9VW77
7227.FBpp0074587 FBpp0074587 FBpp0074587 FBpp0074587 NP_649175.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]