SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0074730 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0074730
Domain Number 1 Region: 163-270
Classification Level Classification E-value
Superfamily WWE domain 3.01e-29
Family WWE domain 0.0000366
Further Details:      
 
Domain Number 2 Region: 117-168
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000099
Family RING finger domain, C3HC4 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0074730   Gene: FBgn0036897   Transcript: FBtr0074962
Sequence length 376
Comment pep:known chromosome:BDGP5:3L:19630868:19635916:-1 gene:FBgn0036897 transcript:FBtr0074962 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQQRSTEQIAASNNNTSDVIALDDDEDTDVQFVAALRPTAPVIDLCVSPSTSAAAAAAA
AAAAHSGGGSGEDPAVGSASGAAASDTDSLASSPDEGALATGVDAAAAVSGEDSPSAAAA
ALECPICLQTCIHPARLPCGHIFCFLCVKGVAYKNRRCAMCRREIPAEFLDHPQLVNGIE
DICTTRATEDGFQWYYEGRNGWWQYDDRTSQDIEDAFKKGDKSCTILVAGYVYIVDLEQL
VQQRQNEPTRCRRVKRDLATIPKKGVAGLRIEGNQVTSDTVFSRPTNTANPTTVAAAASS
FISTIAATDAAIRIASDIIGSTLAHADELTRGLTASNLNDDLSSSDSFSICTPPLLLTAK
CVFVASLISTVYLKLY
Download sequence
Identical sequences Q9VW25
FBpp0074730 FBpp0074730 NP_649138.2.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]