SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0074856 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0074856
Domain Number 1 Region: 93-158
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000198
Family RING finger domain, C3HC4 0.021
Further Details:      
 
Weak hits

Sequence:  FBpp0074856
Domain Number - Region: 183-212
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000366
Family CCCH zinc finger 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0074856   Gene: FBgn0036809   Transcript: FBtr0075089
Sequence length 265
Comment pep:known chromosome:BDGP5:3L:18714993:18716372:-1 gene:FBgn0036809 transcript:FBtr0075089 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTVASNDQHVDTGVLPVPSTNSPSSQIEQKGNEAIVPNYKAATAGEQGEAQAGATCTTV
AVRPSGVATSADIVKGSSSVSSHVQPSWRSSFARSQDKKCGICFETIMEKEGGDKRFGIL
PSCNHVFCFQCICTWRHATQYAYQVTRACPECRVWSNFVCPSAFWVEEKVAKDQLINDHL
AAMRARDCKYFKQGQGVCLFGNKCFYKHSIPNADYVDVGLPTHALGLPIPSDFSGLGNCL
ILVPFPNMFFDDFSNSDDYDFSDVN
Download sequence
Identical sequences Q9VVS2
FBpp0074856 NP_649055.1.81976 7227.FBpp0074856 FBpp0074856 FBpp0074856

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]