SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0074961 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0074961
Domain Number 1 Region: 67-112
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000503
Family EGF-type module 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0074961   Gene: FBgn0052179   Transcript: FBtr0075197
Sequence length 217
Comment pep:known chromosome:BDGP5:3L:17642662:17647380:-1 gene:FBgn0052179 transcript:FBtr0075197 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAQDLLLLATALIGAYLPLTAACSSRAIAKPRPTAAPILPPDNVEISTTPRPNVTFPIF
ACPPTYVAWYCLNDGTCFTVKIHNEILYNCECALGFMGPRCEYKEIDGSYLPTRNRVMLE
KASIVSGATLALLFMAMCCVVLYLRHEKLQKQKLHDSTTTTTTDGGCQNEGMDEVDGLRP
LRPVRRPFGPCRILSLEEAHLQAKASNRPRHCNELLR
Download sequence
Identical sequences Q9VVJ6
NP_524129.1.81976 FBpp0074961 FBpp0074961 FBpp0074961 7227.FBpp0074961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]