SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0075091 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0075091
Domain Number 1 Region: 126-312
Classification Level Classification E-value
Superfamily TRAF domain-like 1.57e-59
Family SIAH, seven in absentia homolog 0.0000000208
Further Details:      
 
Domain Number 2 Region: 66-127
Classification Level Classification E-value
Superfamily RING/U-box 0.000000544
Family RING finger domain, C3HC4 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0075091   Gene: FBgn0003410   Transcript: FBtr0075332
Sequence length 314
Comment pep:known chromosome:BDGP5:3L:16846851:16851812:1 gene:FBgn0003410 transcript:FBtr0075332 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNKINPKRREPTAAAAGAGATGVATNTSTSTGSSSAGNTSSANTSSSSSSSLSSAGGGD
AGMSADLTSLFECPVCFDYVLPPILQCSSGHLVCVSCRSKLTCCPTCRGPLANIRNLAME
KVASNVKFPCKHSGYGCTASLVYTEKTEHEETCECRPYLCPCPGASCKWQGPLDLVMQHL
MMSHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGHHFMLVLEKQEKYDGHQQFFAI
VQLIGSRKEAENFVYRLELNGNRRRLTWEAMPRSIHEGVASAIHNSDCLVFDTSIAQLFA
DNGNLGINVTISLV
Download sequence
Identical sequences B4PK89 P21461 P61093 X2JB60
FBpp0075091 FBpp0075092 FBpp0264891 FBpp0075091 FBpp0075091 FBpp0075092 FBpp0132130 7227.FBpp0075092 7245.FBpp0264891 NP_001287089.1.81976 NP_476725.1.81976 NP_730206.1.81976 XP_001973003.1.56816 XP_002095075.1.41174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]