SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0075392 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0075392
Domain Number 1 Region: 13-73
Classification Level Classification E-value
Superfamily RING/U-box 1.94e-16
Family RING finger domain, C3HC4 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0075392   Gene: FBgn0052847   Transcript: FBtr0075639
Sequence length 164
Comment pep:known chromosome:BDGP5:3L:15114672:15115401:1 gene:FBgn0052847 transcript:FBtr0075639 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSADTFVMDTKDESFYECNICLDTAQNAVVSMCGHLFCWPCLYQWILTKPDHTVCPVCKS
GVDRSKVIPVYARNDKRQEDPRDKTPPRPTGIWSDYANDLELGLFSYLLFGLFFPYGALS
SYLDMDEPLNPAADHGIRDGQNETLLSKFFLYVAIMLIIYMIVI
Download sequence
Identical sequences Q8IQM1
7227.FBpp0075392 NP_730026.1.81976 FBpp0075392 FBpp0075392 FBpp0075392

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]