SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0075454 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0075454
Domain Number - Region: 1127-1192
Classification Level Classification E-value
Superfamily Coronavirus S2 glycoprotein 0.00199
Family Coronavirus S2 glycoprotein 0.0093
Further Details:      
 
Domain Number - Region: 97-249
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.00327
Family Apolipoprotein A-I 0.0097
Further Details:      
 
Domain Number - Region: 810-953,1052-1065
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00398
Family BAR domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0075454   Gene: FBgn0036440   Transcript: FBtr0075710
Sequence length 1333
Comment pep:known chromosome:BDGP5:3L:14690413:14694778:-1 gene:FBgn0036440 transcript:FBtr0075710 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRHQVNIPESGGAFGASKASSEIDLCEDYDDIAKWSDKQLKINDQLRNLQMVMSSIIVSI
NRTTSIEKCCFYENNSMALLIENVNEIDPVNQIESSNDLSTNLKNILSKIKKIIVKAFNS
CCENLRGTIEKAKREVEKKVKDIEIKYEEMDTERSKRSDGIRKKVKQLERRIEAVKSSLD
KLQKKMDTNDGKTNCGEELKEQISVLGSNISTSKTEAENEFNKLNNQLKEIQEELRNQDK
ISDALKKTLEDGAEITKNIIDKTKNNCGIMNSGLDKQIQKEDLIDLKKRTENLQRLVISL
TNKMANFDNQGSATSLSVTLNTCMTNNEKLNTIQSLLQEMIQEQNQTCSKATTEMIKNGS
PPGSPSCSSDEQLKEHLKTLQNESAILDDELKKFPKCCQKIDKLTERAEQITNVLQNMNT
TFNNQIQDNANKFNSLKDGLDATVRRTGKINPPNVNNSVQKQVKELERKVYRAVLNLDAL
KETQYDFIKLMESTKHLKYSPNEMEKLRKDFEEFRLKILRQLVDYDQKKIQEPSTDARQR
EIRLQKIHANVRQDMDKLNNTIQLQDKLKIKAQDEIKKQKTPSKLMLACERKCKEMDHFD
KLLELIEEAKNLVKIKSTTEISTAKPTQKYIKKKKQKNKSKRKPKPKPTREWSGVMVGGI
DFEPNREIIHRRQRSVDRSKRDKNETKGEFTGSTNEDVFIQQCECHAQVSIASLLLVISA
ITVATNTHDYGNIYNQIRAPPVKERCDDYNDISKWIAEQVKLSAQLRKFQRDQNAILSYF
YKTPTSMTCRFYEEITLNRIVEKVNRINEISESQVEKLKISGDLEKDVENVLPQIKKFVS
KGIKSCCENFTKLIEHYKKDLHLKIKNLPNKLNETESEKLNESHSIQKNLGYIEKQVEEI
RPLFQKLQKYFRDSQANSKCCDGLKESFQSLENKLSIIKSNGYNQSLKIENQLKELKDKI
QENVEKTKDIKTTLSHRFENIKNILGICNQSYIHQNVPMDTTIFLDLEKNAETLEKLAET
LFKKLGVLDIHKPSINLNVTLNTCQENNEMLTNIQSKMGYLLKQNSKDCFEGSPTDSKNS
KSLIIKTCSSNEKLQNSIAELEKEIGILRKELNKFPKCCKKIDDLIVHMGKLENMINKMN
QTYNDHLKANSNQLNSIKEGIDKSLRNLGHNHDDDDNKKLQEQARKLKKDLIKASLTLSI
LKERQDDLLKDNNKIQTSLYSPDEMDGLKKELYELRQDIEGKLKDLALKKQSKMDAVKHL
DTFNKEVIQNLDKAKTSTLEHKELDMRIKDQTENQIKQTNEMLHCSKKCLKINMMNDLMD
QVEDMERIVKINK
Download sequence
Identical sequences Q9VUG6
FBpp0075454 FBpp0075454 NP_648715.1.81976 7227.FBpp0075454 FBpp0075454

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]