SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0075501 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0075501
Domain Number - Region: 118-157
Classification Level Classification E-value
Superfamily V-type ATP synthase subunit C 0.0628
Family V-type ATP synthase subunit C 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0075501   Gene: FBgn0036389   Transcript: FBtr0075759
Sequence length 982
Comment pep:known chromosome:BDGP5:3L:13958303:13965106:1 gene:FBgn0036389 transcript:FBtr0075759 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDILDIDEALKDDSYIFLADKTHDDVSNILQQWKTNNQPPLQQLHLQYNNEAFKNNSKTF
TRPKRRNLDFSQNGAGNDSGVGTGSVAGAPAMLQLEIGGLVTTNMHKSFLQDTSPPSSIC
SSMNTERMNNSLITSADFTNLNFLQSTIGLEQDPNLTTTLTNQTTDNMGIGGSIGGYTLS
DMIRDRKALESLTMCEDDGTLIKDSHIGQIDEISLTLSKTASGCSTMDNSTDSMSIPLAA
DRTMPVVVSAVCPALQRTMILGEEMIGDTTFNLVDSLTTSALQSESESLPVDGNATFKRP
TASATTADETQVLTGRQMNTTFTDGCNTPEGRCETPENIDRKLALLTMESSTPLTTNMRS
HCYHNNNNNNKAGYTPTLKGRGDMNLSPIVGATPQKPTGTAPGRLNNTFEPVAKTAPFNG
EKFVLDTMELLEQIEQPLDGTYNLQMSEQHRQMQCVMDLAEAEVEMLAQQGDEEQFENML
AELGKVNTLNEEQLKMQKSLDTIKRRFHRDEAEAEEREEELQQSAAEKVDTPVLNQSHSS
SNSSGGGGERLLSRRSRLYDDVNLSAMHGSNGSSTSTNSASFIVQRRDMPQVEQPAPDPD
PEPAEEPPKSQVTAEIDPASYKLPERRERDRDRFKTIKISKEMRLQPEIIVPCIDDEPQQ
LEDEQKQLVEDVRYEEDQRQGSPPGRLSRRDQTTAISNNADASASNYLTYKKPKEKSLIQ
RRPQQQEAPLLAEPAPASTLPQPRSLSRPRYISGLQKFTTVSKATSAGAGLNATPAAAMP
TTVTVPANGNGELKSPMGIKSKSFHNLSSTMSGVGSGALPRPSLGGGLRRPSAQPSKLMS
GLRGPTQAQEDDSAVFKVPKLVSGLRAPGLAPKRAGANGLARPSSGYYSLSVKTAPEADT
PESLSSASSRGSLYGHKDSGRTVNGGNVPQQNPQQTFDMQALTSKLTQVTTGATGIPKPS
GLRPPSQIKRSGLPRPSSIVRR
Download sequence
Identical sequences Q9VUA5
NP_001287065.1.81976 NP_648672.1.81976 FBpp0075501 FBpp0075501 7227.FBpp0075501 FBpp0075501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]