SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0075556 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0075556
Domain Number 1 Region: 437-503
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000000131
Family SAM (sterile alpha motif) domain 0.045
Further Details:      
 
Domain Number 2 Region: 358-428
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000773
Family SAM (sterile alpha motif) domain 0.057
Further Details:      
 
Domain Number 3 Region: 526-598
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000124
Family SAM (sterile alpha motif) domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0075556   Gene: FBgn0036376   Transcript: FBtr0075814
Sequence length 680
Comment pep:known chromosome:BDGP5:3L:13506464:13509376:1 gene:FBgn0036376 transcript:FBtr0075814 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATVAEGSKMLEAALQQMDGLISSTATQAGSVSISGAGSSLTLSERNLISATNVLSTAKT
LALALQQVGLAAPAPDPVTAAIISDWLETHIPRQDSDERMRRLQRDKEGLALQYQMLAER
VSEQADKIIELEGLITEKSQQLCTKEEQLQRQMISSSALETQKLELMSALSELKLHRTAL
EQANDGGSAISANIPYGSLSNINQKAFMGSPKTPPSALRHQIKPQFHSLPRSHGKFVNNN
NNRALDVNANSSGKQRNVAFASNEHILIDDNHHQAEDAMTSSFMSQFTPSPKLRERSARG
LRNILGKLRRSNSSNCELTALEQAEPEFRRGGARATAGGRIEWSAQTPLFGENEKHWTTW
GAQEVCNWLAYMGLGCYEDNCRKWLNANPSVSFFTASPVDIERELNLKMPLHRKKILLAI
DDLTGKEFDDLTLKASSLDVTWVLRWLDDIGLPQYKDYFMQAKIDGRMLHRLTLEDLSQL
HVSSCLHIASLRAGILCMRRLSWNAEGLIRRSIKVVSEDEAAATPDRDNVELWTAHRIMG
WLQTIDLSEYTPNLRGAGVHGALMLYEPRFNADLLADLLSIPPSKSLLRRHLAMHFKELV
GRPVILSKRDAESAPGYQPLSITAKLKPVKRTQFSLKRRKSSKSQSDVDWTEYVCPMNAS
VPETYLADTAKEHESSMSSN
Download sequence
Identical sequences Q9VU88
FBpp0075555 FBpp0075556 7227.FBpp0075556 FBpp0075555 FBpp0075556 FBpp0303374 NP_001261806.1.81976 NP_648661.1.81976 NP_729920.1.81976 FBpp0075555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]