SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0075570 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0075570
Domain Number 1 Region: 61-435
Classification Level Classification E-value
Superfamily L domain-like 4.02e-65
Family Ngr ectodomain-like 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0075570   Gene: FBgn0023095   Transcript: FBtr0075832
Sequence length 540
Comment pep:known chromosome:BDGP5:3L:13221792:13272742:1 gene:FBgn0023095 transcript:FBtr0075832 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRRRAITMSLAPHLGQAFSLCLCLCLCLVLATLPVALGLANCPNGCECDDDTLMVNCGE
GTLDVLPIALNPAIQRLVIKNNKLKTIDSSMQFYAQLTFLDLSFNDMLTIPERSFAYHAK
LQELHLDHNKIGQVSNKTFLGLSTISVLNLRGNLIAELEYRTFSPMVKLAELNLGQNRIS
HIDPHALDGLDNLRVLYLDDNTLTTVPGELTFQALHSLAELYLGTNSFMTIPGGAFQDLK
GLTRLDLRGAGLHNISGDALKGLVSLRFLDLSDNRLPAIPTAAFQRLGRLEQLNIGQNDF
EVISSGAFSGLRELRHLELTGAQRLRRVESGAFSGNTNLEHLNLSSNKQLNELSSIALGG
LPHLSTVVLKANQLSSLDEGLVPWADLQTLDLSENPFECDCRLLWLRHLLVSRNASGQYA
PVICAYPTALRDLPLAHLAEPLLGCAHGAASKQAIIGILVVACAALITTLALVLYTCRHR
IREMLKGHSALGRKEREYQKTFSDEEYMSRPPPGGGGVHPAAGGYPYIAGNSRMIPVTEL
Download sequence
Identical sequences Q9VU53
FBpp0075570 FBpp0075571 NP_524056.3.81976 NP_729880.2.81976 FBpp0075570 FBpp0075571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]