SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0075624 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0075624
Domain Number 1 Region: 43-424
Classification Level Classification E-value
Superfamily L domain-like 3.09e-63
Family Ngr ectodomain-like 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0075624   Gene: FBgn0010452   Transcript: FBtr0075890
Sequence length 737
Comment pep:known chromosome:BDGP5:3L:13107371:13111177:1 gene:FBgn0010452 transcript:FBtr0075890 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQRNMMIAFVGIWCILASIGVEPAAGLANCPPGCQCDDNTLVVQCGEGQLDVLPIALNPS
IQRLVIKSNKIKTIDSSIQFYAELTFLDLSSNHLMTIPQRTFAYQKKLQEVHLNHNKIGQ
ISNKTFIGLSAVTVLNLRGNQISELHQGTFTPLLKIEELNLGENRIGYLDPKAFDGLSQL
RILYLDDNALTTVPDPVIFQAMPSLAELFLGMNTLQSIQADAFQDLKGLTRLELKGASLR
NISHDSFLGLQELRILDLSDNRLDRIPSVGLSKLVRLEQLSLGQNDFEVISEGAFMGLKQ
LKRLEVNGALRLKRVMTGAFSDNGNLEYLNLSSNKMLLEVQEGALSGLSQLKHVVLKANA
LTSLAEGLFPWKDLQTLDLSENPLSCDCRVMWLHNLLVAKNASQDDVSELLCEFPERLRG
ESLRHLNPAMMGCTHADPRKQALIGALLVGSAATITALALVLYRCRHKIRETIKGGLWGN
SALGRKEREYQKTFCDEDYMSRHQHHPCSLGIHSTFPNTYTAPHHPGATHHYGMCPMPVN
DLGAIDPQQKFQQLVVPTATMISEKKLNNNKALVSQGAIDDSASFVLHMKSATMGRDVHQ
QNPQLNHYTKPQFLSATATVGDSCYSYADVPMVHGAPLGGPNQPQLRLTQEHFKQRELYD
QEMGSEILDHNYIYSNTHYSMPLEQLGRSKTPTPPPMPPALPLRNGLCATTGRRSFQQKS
ASQKQQQNNNTLRQFTH
Download sequence
Identical sequences Q9VU51
FBpp0075624 FBpp0075624 FBpp0075624 NP_524055.2.81976 7227.FBpp0075624

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]