SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0075701 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0075701
Domain Number 1 Region: 686-808
Classification Level Classification E-value
Superfamily Bromodomain 2.22e-37
Family Bromodomain 0.0000185
Further Details:      
 
Domain Number 2 Region: 496-628
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.4e-18
Family N-acetyl transferase, NAT 0.00000189
Further Details:      
 
Weak hits

Sequence:  FBpp0075701
Domain Number - Region: 21-117
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0204
Family beta-sandwich domain of Sec23/24 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0075701   Gene: FBgn0020388   Transcript: FBtr0075969
Sequence length 813
Comment pep:known chromosome:BDGP5:3L:12514229:12517114:-1 gene:FBgn0020388 transcript:FBtr0075969 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGGPSITIKSQPIDGNNTGNAAAQQQQQAANGAATAGASGAAGSAQNPGHGGAASGAGS
VPAEGTRQNSLQRIQQRKQKVFNLPVPQKLAKLSMYSACQSEGCRCTGWKTPQENRHRDV
ESSYCPEFNEECRNTSCRHSLRSHIAHLDNISSSSMNELLGAIIDMENLFMSMQRVEDED
TKKVYQYLFRLLRQCVLTRQQAVIRGPLGDPPFETPCITKAVLSLVFYKYNHLSTPELQT
MTEVAKTFLNFLNHYNFESPSTRRGDLTHEDASNYKINYTRWLVFCHVPAFCNSLRQCET
SLVFGRTLLRTVFQCMSQQLKKKCISERDRFPEDKRSIITLMPKFLETLRAELLKDDSPI
WDTSYRPSNSFVIQQRKRNQEVANVPIGPSAASIGGNKRTSVGEPLHKRIKKEPTDRPSS
ENLDDLPADVVMRAMKSVSESKTTNKAEILFPVNVSRDENVKAEEQKRAIEFHVVGNSLT
KPVDKQTVLWLLGLQLVFAYQLPEMPREYISQLVFDTKHKTLALIKENQPIGGICFRPFP
SQGFTEIVFCAVTMSEQVKGYGTHLMNHLKDYSIQRGIKHLLTFADCDAIGYFKKQGFSK
DIKLARPVYAGYIKEYDSATLMHCELHPSIVNTQFIAVIRSQSEILKELIAQRHNEVQKV
RPGLTCFKEGLPVIPVESIPGLREIGWKPQNRPARSSRPLEESTDPEKLATSFASVLQSV
RQHTTAWPFLRPVTAAEVPDYYDHIKYPMDLKTMGERLKKGYYQTRRLFMADMARIFSNC
RFYNSPDTEYYRCANSLERYFQTKMRELGLWDK
Download sequence
Identical sequences Q9VTZ1
FBpp0075701 NP_648586.2.81976 FBpp0075701 FBpp0075701 7227.FBpp0075701

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]