SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0075763 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0075763
Domain Number 1 Region: 46-166,201-252
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 6.5e-16
Family AlkB-like 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0075763   Gene: FBgn0036210   Transcript: FBtr0076031
Sequence length 255
Comment pep:known chromosome:BDGP5:3L:11808579:11809810:1 gene:FBgn0036210 transcript:FBtr0076031 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIIQNRSPLIGHILRRCHRQAVESNAIKANLTAYFGKWPETEQKEFRQHMRIITDFISEP
EEQQLHEEIEPYMSRLRYEFDHWDDAIHGFRETERKKWFPKNREILERVRQVAFDGAVMP
YVHILDLAPDGVIKPHVDSTRYCGNTISGISLLSDSVMRLVRTDEQRYQQQSSGTATDPN
SQGSEPDAAYRHQPEASLKNNFYADILLPRRSLYIMSHTARYKFTHEILAKEHSQFQGAL
VPRTRRISIICRNEP
Download sequence
Identical sequences Q9VTP1
FBpp0075763 NP_648511.2.81976 7227.FBpp0075763 FBpp0075763 FBpp0075763

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]