SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0075788 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0075788
Domain Number 1 Region: 1051-1383
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.61e-65
Family Ankyrin repeat 0.0000358
Further Details:      
 
Domain Number 2 Region: 1405-1513
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000000557
Family Tetratricopeptide repeat (TPR) 0.0045
Further Details:      
 
Domain Number 3 Region: 527-579
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000762
Family RecA protein-like (ATPase-domain) 0.091
Further Details:      
 
Weak hits

Sequence:  FBpp0075788
Domain Number - Region: 91-139
Classification Level Classification E-value
Superfamily RING/U-box 0.000132
Family RING finger domain, C3HC4 0.015
Further Details:      
 
Domain Number - Region: 552-610,653-705
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00026
Family RecA protein-like (ATPase-domain) 0.096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0075788   Gene: FBgn0041096   Transcript: FBtr0076056
Sequence length 1569
Comment pep:known chromosome:BDGP5:3L:12001325:12049574:-1 gene:FBgn0041096 transcript:FBtr0076056 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFPLTNRSSSGNRTNNNPSNNNNNQTTSFIIGGTTNINNNNNQLGGTNSAKDKGNFENNW
SCNKTTGRRSGSGNSCSFLDLQSIRRLLEHDASGSVCPSCRISFDKGKRRKLIDTCGHER
CYSCMFRNDQCPMCMNSSLKDVDGANAQGYDTGIGGSTSTIVSPLGSPQPQLRSHAQRNA
ALARYMQQHRQESQSPDYHHRYASNGKLPRAAALSTNGNGFTTGTTQTVTVDVHHQLGGG
GGGAAAAAKQLMANGISGHSRSSSMSHNIHAAAYSELSAAPPAFATPPTRRRFFNHKNLR
SALTGGSGGGSGVGGGVGGAGGVGGGHRRTASNGGCPIDTASILSGGSDAIDHHSSFLNE
KLQKDQLHARLGLLLNDPGSNGNSSSSGSGCEPISAHSTTSTTSSSGVGAASTTTSGSSQ
NVSPEQTLASGAGMLSGSQLSVATSHGVKEDALSLCGKFKAGCSMLHVYEALPSKSRKGN
VRRSTRGQQGSSSSASAASAVGSRVTASSLAAVQLALKPLFFEVPLQEPDPPYVGRQWLV
QQLSNILLGTETRVVLINGQPGTGKTAFCLQLVEYSCFGRRQMQDDPDGIYSQLQLGAHC
ERMRGLASHMVGYHFCQADANLTCQVPDFVHSLAAQLCQAPQLTAYRDYLLSEPHLQDIL
SVRECIADAERVMKLAILEPLAHLHRAGKIPAKVAVIVVDALCEAEYHRPDHGHTIASFL
AQLTPHFPAWLKLVATVRTQMLELVKAPSYTQLTLDSWASSQALQQDMLDYIGARLADSP
EIRMNIGGGGGQNSQSGSQPQTKFVSHLQSLSRGSMLYAKLILDLIARGQLVIKSSSYKV
LPVSLAQIFLLHFNLRFPTARSFEQAAPILNICLAALYPLTLDEIYYSMEALSHGREALS
WPDFMQRFKLLDGFLIKRLDNTYMFFHSSLREWLMRRDEGESNKFLCDARLGHAGIAFRL
SRLQAPLSPQLTLELGHHMLKAHLYGGTSLTLLSPRDLQSYWLAGAADNISSSLGALRNV
YSPNLKVSRLVLLAGASPNHRTDYMGGAPILCIAAHEGILPMVSLLLEFGADVGLTNSQG
CTPLILAAMRGHCDVVRPLVAAGSSLGQLDITQRCALVHAARMGHLSVVKYLLACDWSPR
PHSQDVTRSVALQQALIGAAAQAHCKILEDLLDLNETEFDLDVNGMEPSSGELALTAAAR
HGCIDVVGILLSRGAQIDARNRQGYSALWLAVKEGHWSVVEHLLQRGALLDEPLGQTRKT
PLMIAAEEGHLELVDLLLARGAQREAQDHEGFTALSWACLRGHLAAAKTLIEHGCNRHHE
DHNGRTALDLAAYQGAASLVIYILEQGGNLEHIDVHGMRPLDRAIACRNIQAVQVFLRKG
AKLGPTTWSMAMGKPEILVILLNKLLEDGNVLYRKNRFQEAAHRYQYALRKISGLEQLLE
RNAIFAQLRTNLLLNLSRCKRKLNELDASIDLATQAIAQKPHSYEGYYARAKARMELGAL
NEALVDANEAMQQAAQSGVLCEVVEVLKRIQTELLTRISISSEDQTGRMSNIGGGASVAY
ESHHEITDL
Download sequence
Identical sequences Q9VTS8
FBpp0075786 FBpp0075788 FBpp0075786 FBpp0075788 NP_648542.1.81976 NP_729779.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]