SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0075877 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0075877
Domain Number 1 Region: 448-638
Classification Level Classification E-value
Superfamily MIR domain 1.44e-48
Family MIR domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0075877   Gene: FBgn0003292   Transcript: FBtr0076146
Sequence length 886
Comment pep:known chromosome:BDGP5:3L:11577222:11580867:-1 gene:FBgn0003292 transcript:FBtr0076146 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSATYTNTITQRRKTAKVRQQQQHQWTGSDLSGESNERLHFRSRSTNSMQQHTAISNSPS
PLCCNGARALTMLNCCVDVNCHLNAPLRGSVNRHTTPTPTPTATPTPVATPKQASPSPTS
DRSRSLSRSPSPSRSRSLSCQKQIDKNSAGAASAEERKTANASSQPFTVNLRIDLFSWTL
FLLAFGTRFYKLATPPHIVFDELHYGKYISMYMRNIFFFDQHPPLGKQLIAGLVSLAGYD
GNYTFTRIGEPYSPEMPIFWFRFLPAMCGSLLAPAVYNLLLEAKLSRWSSALGGLLVVLD
NSLLTQSRFVLMESMLLLATTVGIACLLRFQRSRLGSLEWFFTGTAAAVCLGAAGTVKYV
GFLALGLAFYLLCRHLWQLLYDAGLTDRQLWMHAISRLLIFVGIPLAVYLGVFYIHFKTL
HRAGPHDSIMTSAFQASLDGGLASITKGQPLAVVHGSQITLRHTHGRTCWLHSHAAVYPV
RYPDKRGSSHQQQVTCYSFKDVNNWWLVKRPTKENLVVGDEPDIIRHGEIIQLVHGITSR
ALNSHDVAAAMTPQCQEVSCYIDYEIKMAGELLWRVEILNRDSEGDIWHAIKSEVRLVHV
STEASLKFSGRQLPEWGFNQHEVVADREKAIHEDAIWNVEEHRYTQTEDHRERERQMLTA
EMIPTKRTRISFWAKLLELQSKMLFQTKSVPNHMYSSMPHEWPLMDKGIAYWLDSQSSAQ
IYLLGNILLWYTATMGILVYAGLLAFYAMRRQRLCFDISEQEWQRFVLAGDTFFMGYVMH
YIPYFCVDRTLFLHNYLPAFVFKLLLLCFVVEHLDYLLRRFCTGRGVHLVRLYRLMLILW
LVGVLSIFSKFIPFSYGARKMTLNEVRSLRWKDTWDFVLHKNHHLY
Download sequence
Identical sequences Q9VTK2
FBpp0075877 7227.FBpp0075877 FBpp0075877 FBpp0075877 NP_524025.2.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]