SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0075945 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0075945
Domain Number 1 Region: 2-234
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 7.15e-68
Family IMD domain 0.0000248
Further Details:      
 
Domain Number 2 Region: 364-418
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000171
Family SH3-domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0075945   Gene: FBgn0052082   Transcript: FBtr0076216
Sequence length 1076
Comment pep:known chromosome:BDGP5:3L:11129149:11157084:1 gene:FBgn0052082 transcript:FBtr0076216 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAEEVTKLVDGVYRNILDRFNPGARQLIAAGKSYLKALHGAATASRLFNEALAKIAMNA
QQSGTGDIGSALMSVVNVNKEIQDQQMNILKAFYVDLLVPLETNLEKDTKVVQHEQKKFL
QQHKVRMESYQKAVSTMKKQRKKKATPENTEKELRSLQLLEDQKKKLDVFCDQSYKNAMT
QERRRYGFVLERQCSIAKHWMVYHTTGKTVIDNNFENWQEIAASREIIPPAAYESGYSTS
NGHNNNNISSSSSSGNNNTSGNMRRLERIKDGDDDHLQGHGAQLKKSRSIDAPYGDMRTL
HERENLSGLGGTGPAHYAQNSLPRAKSDFNLALVGTGQSSANKHKIIEEQLATLGDDQRG
DQRPLVKALYAYMPSGENQLSFEEGDRIALVGGKAKGWQFGENLRTQHFGWFPVAYTNAE
VAEVTTSGGRRYENMLMSYERNGGGSGSGSGGGGLRSYQQQQDYEAQLELMESHEATYRR
RRNHSAEDSSPTRMFGDTIKQQKKYRPGSGANPRPGPPPTLPAPVPNGPQSQSSRMLNSS
QSFCASNGGGVNAAVERRKQKLLNGVQSSKNHPSGKSGVAAKTSLHSSNDSGFANEPPPQ
PEVDYSDEEPATQRVAIRRRADTNSHTNTVPRDVASWTLNRNFRNSVDSQIDDKSLHRLS
RQSGGVGKMRYDLIASDDEILQASSAGLKRTKSFWKFGGGRNGEDILAGMSLWQHRDLVA
APNLEEMRDRDDLERRLEEDRNGTLTKSHNSSSSQEKRERKDSLTSTELYGDEDENIYGV
SPQQPPLQQQTQQHQQHQQHQQQQAQQHRSSYTPKSRMKIMKTIEIDIEEPTEAERMSTM
RRGQSQDQQQQHRKLDKQVSGTGSQHKSLTLSRTKSNQQQQQQQQFPQSTDEGESDEHGT
LKLSDVNNFFDGEGKNNSHGHGLVMKTVKRQDILKQYYTSEDEEDSDAELKSTSSDPYDC
IVINDHLVRKDDKMRRHHQQQHQQMATNTLKKSSSKDQDSTLTRNSTASSGAPTATILPR
TRLLKSSTSAGNNIGNSSATLERNSKGLAGNKSYGPWYDFWDQEQHGQKSASAKLK
Download sequence
Identical sequences Q8IQE6
FBpp0075945 FBpp0075945 NP_729679.2.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]