SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0075997 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0075997
Domain Number - Region: 755-823
Classification Level Classification E-value
Superfamily RING/U-box 0.0283
Family RING finger domain, C3HC4 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0075997   Gene: FBgn0026160   Transcript: FBtr0076268
Sequence length 1149
Comment pep:known chromosome:BDGP5:3L:10862928:10868843:1 gene:FBgn0026160 transcript:FBtr0076268 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPHCVIPVYYTQWPYYIITLWIPTNSWLYLVYELCRKNDEMNQQAGSSRAPATGGQISPP
GATTVGVEQQQHLQQQHQQQYYNQQQQQQQQQYQQQHQRDNFLAYQQQQQQQQQQQQQLQ
RSGGGGGNFMLGNDLVGGDSLRSLNNTFGPNSEFTSLGGANSSASSSLSGLSSSSSQGYT
GMVAASQQHQQQQPHHHQQQQQQQQQQHMGSMDAMGGYSQMGGGMHPGPNSGMMGNMNGQ
YMNGGSGQGGYNGAQGMGMGYGGGGSMGPQRHHQMTPMNQMQNMSMGPGVGGSGGMGGGM
NPLQQQAAQQQMGGMNPMAKMQGMANGGYPQQAPPSLTQQQQQQQQRRMAPYPHPQMHMA
QKRAAAGVGGAGGMYPGNPMQQQQAQMYGNQQMHPGSGGGVPLPMQAGGAGNGYGRSGPM
GVGNGGYGRMSAGNGMGPTGGPVMGPMGPGGMTAGGMGPGPGCMSQQRFMPQGSGGGMPG
VGYGGVGGAASHQGQFYPGSGQSAGMQQAGGMCPAGPGAVATTGNPYQNQGFQQNYQHSP
VPGNPTPPLTPACSVPYVSPNPDIKPPMDNSEEMRLTFPVRDGIILAPFRLLHNLSVSNH
VFHLKQNVYNTLMCRNDLELQLKCFHQDDRQMNTNWPHTVTVSANATPLNIERSEKNSTA
LRPLYLKAVCQPGRNTLQLTASSCCCSHLFVLQLVHRPSVRQVLQTLHKRNLLPLEHSVQ
KIKRNLSQPEANAGPDATPQQQQQQGGGQQCAKISLKCPITKSRIRLPARGHECKHVQCF
DLEAYLMINSERGSWRCPECSKSAITDTLEIDQYIWAILNTLGNSDVDEVIIDSSANWRA
LQHNGGMPNAPPPSNVPSNPSGGSGSNSGNGSVNPTLPVIKQELCDDIAKVMSPGSTQLP
TWDSAQAMSPYNMHDMNSIASGNMMGNGGNTNQHGNRSSYDGFSGNHSDGSGGLPGGDGG
VNSLDQLNAMEKSLSDQMPHTPHTPGAASHPMTPGGPPSVSSSHNEPISGGTPNANGSGS
ATNGSGNNNSSTGHNSPQTPGTPSRMGGGMGGSGSADSQQQQQEQLLNSLMSSQTQLKFS
ESDLSAELQSFDAAAAAINDTAHDLNLLQDVDPMEILSYLDPQPDLNTPPSSGSSNNNAS
DDLLATLFD
Download sequence
Identical sequences Q7KUE4
NP_729629.2.81976 FBpp0075997 FBpp0075997

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]