SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0076139 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0076139
Domain Number 1 Region: 170-499
Classification Level Classification E-value
Superfamily L domain-like 1.43e-50
Family Internalin LRR domain 0.029
Further Details:      
 
Domain Number 2 Region: 77-186
Classification Level Classification E-value
Superfamily L domain-like 0.0000000000000111
Family Internalin LRR domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0076139   Gene: FBgn0036040   Transcript: FBtr0076410
Sequence length 552
Comment pep:known chromosome:BDGP5:3L:9724338:9726907:-1 gene:FBgn0036040 transcript:FBtr0076410 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQTANWVLPLLLWLLCMGFPILHGADLCQPIGWRNFQCSEVASLQDLVDLGAENWHTLA
IRNVQTELEVGSGENADHLANLLDLDLTGAAPINVHTNGFSILPNLRQLNLSGCGLVDIR
GNHFAPESALQRIDFSHNQMELLDRDFFGNLRKLIYANFSHNALKQCDLPHMPLLNRLEL
GHNRLVNATFGVCPQLQELILNDNQLIQLDVNAFRGLHGLLELQLSGNRLSSIGLETFQP
LAQLRKLNLSQNALDALRPNVFGAVQNFVLHLQQLDLSGNRIRLLFDNQFRVLARLQMLD
VSRNSIASLSPAHFVGLGSLRKLYLQYNAILEIKPATFAALLNLDTLDLSYNNLEFLEEQ
IFGGNTLPRMRRLNLNGNRMKHLHPLAFSSLPFLEYLKLGHNELKSLDVRMFAPMRRLQK
LHLGHNLLEEINLDVLESLSSVQEILVDNNRLTFLAKVNVSFPNLKRVAIEGNPWQCPCF
VKLQHWLATRDVVYLRDNTGYYKGERPLCIVTNVDYCIQNLQAVRRLGILGDFQGEQVEA
DAFDDDASAAQD
Download sequence
Identical sequences Q9VT44
FBpp0076139 NP_648354.1.81976 7227.FBpp0076139 FBpp0076139 FBpp0076139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]