SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0076340 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0076340
Domain Number 1 Region: 154-216
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000002
Family SAM (sterile alpha motif) domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0076340   Gene: FBgn0010431   Transcript: FBtr0076613
Sequence length 217
Comment pep:known chromosome:BDGP5:3L:8406112:8407203:1 gene:FBgn0010431 transcript:FBtr0076613 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENSRTPTNKTKITLNRTPTLKERRWNTLKVNTSNVRCSTPIFGNFRSPNLSPIENMGTK
GKSPVSPMRFATFKKVPTKVHPKQQQQQQHQHCHRTQLKPPPFVLPKPQEEIIEPEREIK
SCSSPDTCSDDSNMETSLALESRRRSIKASNHSYVVNHAANVEQILMHMGLENYVTNFEE
AHIDLVELASLERADLVKIGLNTDEDCNRIMDVLHTL
Download sequence
Identical sequences Q23973
FBpp0076340 NP_648223.1.81976 FBpp0076340 7227.FBpp0076340 FBpp0076340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]