SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0076341 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0076341
Domain Number 1 Region: 37-165
Classification Level Classification E-value
Superfamily N-terminal domain of cbl (N-cbl) 8.5e-59
Family N-terminal domain of cbl (N-cbl) 0.00000264
Further Details:      
 
Domain Number 2 Region: 252-338
Classification Level Classification E-value
Superfamily SH2 domain 8.29e-46
Family SH2 domain 0.00000948
Further Details:      
 
Domain Number 3 Region: 346-423
Classification Level Classification E-value
Superfamily RING/U-box 3.73e-39
Family RING finger domain, C3HC4 0.0000245
Further Details:      
 
Domain Number 4 Region: 167-251
Classification Level Classification E-value
Superfamily EF-hand 1.77e-35
Family EF-hand modules in multidomain proteins 0.0000242
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0076341   Gene: FBgn0020224   Transcript: FBtr0076614
Sequence length 448
Comment pep:known chromosome:BDGP5:3L:8418054:8421755:1 gene:FBgn0020224 transcript:FBtr0076614 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATRGSGTRVQSQPKIFPSLLSKLHGAISEACVSQRLSTDKKTLEKTWKLMDKVVKLCQQ
PKMNLKNSPPFILDILPDTYQRLRLIYSKNEDQMHLLHANEHFNVFINNLMRKCKQAIKL
FKEGKEKMFDENSHYRRNLTKLSLVFSHMLSELKAIFPNGVFAGDQFRITKADAADFWKS
NFGNSTLVPWKIFRQELNKVHPIISGLEAMALKTTIDLTCNDFISNFEFDVFTRLFQPWV
TLLRNWQILAVTHPGYVAFLTYDEVKARLQRYILKAGSYVFRLSCTRLGQWAIGYVTAEG
EILQTIPQNKSLCQALLDGHREGFYLYPDGQAYNPDLSSAVQSPTEDHITVTQEQYELYC
EMGSTFQLCKICAENDKDIRIEPCGHLLCTPCLTSWQVDSEGQGCPFCRAEIKGTEQIVV
DAFDPRKQHNRNVTNGRQQQQEEDDTEV
Download sequence
Identical sequences O46034
NP_729382.1.81976 FBpp0076341 FBpp0076341

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]