SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0076507 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0076507
Domain Number 1 Region: 226-518
Classification Level Classification E-value
Superfamily L domain-like 5.95e-42
Family Internalin LRR domain 0.033
Further Details:      
 
Domain Number 2 Region: 63-285
Classification Level Classification E-value
Superfamily L domain-like 1.25e-31
Family Ngr ectodomain-like 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0076507   Gene: FBgn0052372   Transcript: FBtr0076793
Sequence length 817
Comment pep:known chromosome:BDGP5:3L:7512583:7521113:1 gene:FBgn0052372 transcript:FBtr0076793 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSLVYTVFHLASLQCSVRPEISPCTCETGKAWNHVELSCEKLESFNAVVDSLANKLNAD
TNIDLKITHSQLDDLEMRSFTDMNFNLYKLRMQWNSLKSLPEVPFRGLSNVTYLSIGDND
LDEIPKHALSHMPSLLTLDIGRCKIRAVQQEDFRGIQRVTNLILVSNIITRLDRGSFPKS
LLILHLGRNQLESLNGSLHDLHNLESLFINANNITSLDDELPDGGQLRLLMAHNNRLERL
PANMAGMHSLETVHIHCNQLRSFDRVLRNAVNLSEVMADNNELEYLAQDEFASCSKVETL
QMGCNHIKSLNSSLLPILKLKNANFSFNDIEEFSMAELHGLRSLKTLQLSSNRIQRLLPD
PRGVQELMLVNLDLDNNRIDSLNGALAGLGNLRILNLAGNRLEHLQVGDFDGMIRLDILD
LTGNQLAELKPLEMTLLPSLKILKVAYNNITKLEQDFKGLPVLCQANLTNNQISTISSEL
VTNTRCKNHNVPGKLEIHLDDNPIMCDVGLNELCRLMAVQEARIRGRSQCFENDQEVCTV
LPMLYNVNLPIMVTNLKLTGREVPKPMVRVIVPSLIKANNELLPPLIATLGNPVLISTDL
VNPVISPLPPPLLLATTTPPPPLPLPVESEVEKNESTTANPVPTNYTQETTTTTSTTTTT
TTTETSSQVAPIEIITTTAPTTTTTSTTTPKPNETLPVIVELQDPNPPDTTVNQTALVPP
VVLDPLQQDLERERERERERELERDLDHEAVAKTEYETVEYIPNLVQPPVGSDALTPPPS
KANALEEDSESVHSNSVHAEYPHAAQSLQIPEEPPEE
Download sequence
Identical sequences Q9VS84
NP_001261524.1.81976 NP_729265.1.81976 7227.FBpp0076507 FBpp0076507 FBpp0076507 FBpp0304454 FBpp0076507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]