SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0076695 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0076695
Domain Number 1 Region: 130-242,315-486
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.000000000494
Family Quinoprotein alcohol dehydrogenase-like 0.031
Further Details:      
 
Domain Number 2 Region: 1141-1196
Classification Level Classification E-value
Superfamily RING/U-box 0.00000167
Family RING finger domain, C3HC4 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0076695   Gene: FBgn0035704   Transcript: FBtr0076986
Sequence length 1229
Comment pep:known chromosome:BDGP5:3L:6484330:6488397:-1 gene:FBgn0035704 transcript:FBtr0076986 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSELKAPSLQSLLESERGSTDSLLAESLQLDFEDLDDAEFAIPPTDVLPTLEAVLSEFEA
DSDVASEFGMPVPHATPTPSIGEDSTIRTDGRGGGGSIMRYTLLHGISAQLSSAAERVNA
GAASSCAVAAFIAIGTSHGHILNFDVTQTLRWAHQDKHGQGAVASLAFNADSTRLLAGFS
RGLVAMLDTHTGDVLRELFDVITPNTGVLHVKWTSRSSLALCADAGGSVWSLSFTRKLGI
RGCQSRCLFSGARGEVCAVEPLIMDSQGRHELDQYCIVALATLSKYFIVTVRPRLRVIKY
HVLQGPPDCLPLLAWHLVLIQAADTSRSVDPVIVVGRGNQLFFHQLFVSNGRITLLYLRH
VQLQGSLLSAHWLGPKCVASLDTAEILHLVDVRSSKELECMDMANAGLVYGSAQFKGLAT
GGNVSPAFALAGSNACYNSVVSRGTQLYVLGARSLHIIGVRTWSERISFLVKHHRWQEAC
QLALDGYIASVDRPRKRAQAKERIIMLFKEYIANSARAPEYCLGAIVNCLITVGELDLLW
TQLWEKLHNSSTELFLQHISEHIEKETIHSVNPVISQALVDYWLEHSPAKLEQLILKLDW
MCLDLNQVLKAVKKHRLFRAQIYLNTQALNDYTAALTELLPLVTPDETDLGNCLLVYVSS
CLAGREYPSGEIPVELVHQVKHDVLRCLTSQHSKENAGDELPYPYLRALLKFDTRETLNV
ISLAFQEREFSNELGISHRKRIINLLLEIMSPENATWAEIGCLLNFIAQQISMQCLPRDR
QLLERVLSHLAQEEIANESSRQHSERENAWHELLSSNCLAEISSDEEQLRLAEKAKCYCV
VEYLLEKLERYDTILDSYIRNEARHETMFAYMERHVASPKRSIFRQLKRNLRELLTINAK
ETTRLLSLHYPEKINELLDNLRREENLLYLFLKCLNDRKSELEASQMELLLELYCKMESS
STVEEFLRSNSGYRLENAIAIAESHHLNRSVIYLYEKQESYAKAFELSMELLKSAAGEEA
AKEAQTISALLARSVETLPAQELERCWFALLQYILPHQELQSITKSLLHEASQHIDLHNL
VQLIMNTHNVSTSFGDIKDLLMGMLDSSRHKTEALRASAGALCQDLHLKFVKRYQHAHRG
LWVTTTKCSMCRQRLYDHSQVLIFGGCGHGIHEQCMEESETQFEECPRCFTAIPDQSIGL
PRPNKNLISISSSLEMGALQLKAPPRRFI
Download sequence
Identical sequences Q9VRX2
FBpp0076695 7227.FBpp0076695 NP_648048.1.81976 FBpp0076695 FBpp0076695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]