SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0076893 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0076893
Domain Number 1 Region: 4-385
Classification Level Classification E-value
Superfamily L domain-like 4.65e-67
Family Internalin LRR domain 0.032
Further Details:      
 
Domain Number 2 Region: 489-624
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 1.33e-33
Family Gelsolin-like 0.00043
Further Details:      
 
Domain Number 3 Region: 1130-1250
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 1.04e-24
Family Gelsolin-like 0.00092
Further Details:      
 
Domain Number 4 Region: 725-832
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 3.57e-24
Family Gelsolin-like 0.0018
Further Details:      
 
Domain Number 5 Region: 895-930,958-1033
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 3.04e-20
Family Gelsolin-like 0.0097
Further Details:      
 
Domain Number 6 Region: 608-707
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 3.27e-18
Family Gelsolin-like 0.0019
Further Details:      
 
Domain Number 7 Region: 1039-1142
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 0.00000000000000164
Family Gelsolin-like 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0076893   Gene: FBgn0000709   Transcript: FBtr0077192
Sequence length 1256
Comment pep:known chromosome:BDGP5:X:21210823:21216117:1 gene:FBgn0000709 transcript:FBtr0077192 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVLPFVRGVDFTKNDFSATFPSSMRQMSRVQWLTLDRTQLAEIPEELGHLQKLEHLSLN
HNRLEKIFGELTELSCLRSLDLRHNQLKNSGIPPELFHLEELTTLDLSHNKLKEVPEGLE
RAKNLIVLNLSNNQIESIPTPLFIHLTDLLFLDLSHNRLETLPPQTRRLINLKTLDLSHN
PLELFQLRQLPSLQSLEVLKMSGTQRTLLNFPTSIDSLANLCELDLSHNSLPKLPDCVYN
VVTLVRLNLSDNELTELTAGVELWQRLESLNLSRNQLVALPAALCKLPKLRRLLVNDNKL
NFEGIPSGIGKLGALEVFSAANNLLEMVPEGLCRCGALKQLNLSCNRLITLPDAIHLLEG
LDQLDLRNNPELVMPPKPSEASKATSLEFYNIDFSLQTQLRLAGAAVPPSMPSSATPKDS
TARKIRLRRGPRSEGDQDAAKVLKGMKDVAKDKDNEAGAVPEDGKPESLKPKRWDESLEK
PQLDYSKFFEKDDGQLPGLTIWEIENFLPNKIEEVVHGKFYEGDCYIVLKTKFDDLGLLD
WEIFFWIGNEATLDKRACAAIHAVNLRNFLGARCRTVREEQGDESEQFLSLFETEVIYIE
GGRTATGFYTIEEMIHITRLYLVHAYGATIHLEPVAPAITSLDPRHAFVLDLGTHIYIWM
GERSKNTLNSKARLMAEKISKTERKNKCEIQLERQGEESAEFWQGLGMTSEEADAAEPPK
EHVPEDYQPVQPRLYQVQLGMGYLELPQVELPEQKLCHTLLNSKHVYILDCYTDLFVWFG
KKSTRLVRAAAVKLSRELFNMMDRPDYALVMRVPEGNEMQIFRTKFAGWDEVMAVDFTRT
AKSVAKTGANLTQWARQQETRTDLAALFMPRQSAMPLAEAEQLEEEWNYDLEMMEAFVLE
NKKFVRLPEEELGRFYTGECYVFLCRYCIPIEEPENGSEDGANPAADVSKSSANNQPEDE
IQCVVYFWQGRNAGNMGWLTFTFTLQKKFKAMFGEELEVVRIFQQQENLKFMSHFKRKFI
IHTGKRKDKAHTAKGKSPVEFFHLRSNGGALTTRLIQINPDAVHLNSTFCYILHVPFETE
DDSQSGIVYVWIGSKACNEEAKLVQDIAEQMFNSPWVSLQILNEGDEPENFFWVALGGRK
PYDTDAEYMNYTRLFRCSNERGYYTVAEKCADFCQDDLADDDIMILDNGEHVFLWMGPRC
SEVEVKLAYKSAQVYIQHMRIKQPERPRKLFLTMKNKESRRFTKCFHGWSAFKVYL
Download sequence
Identical sequences Q24020
FBpp0076893 FBpp0076893 7227.FBpp0076893 FBpp0076893 NP_525097.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]