SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0077037 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0077037
Domain Number 1 Region: 19-153
Classification Level Classification E-value
Superfamily L domain-like 9.01e-27
Family U2A'-like 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0077037   Gene: FBgn0014395   Transcript: FBtr0077345
Sequence length 395
Comment pep:known chromosome:BDGP5:X:21851573:21853299:1 gene:FBgn0014395 transcript:FBtr0077345 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLITEELVRKKSEHNERLISTLEEISLHQEDIEVIEHIQNWCRDLKILLLQSNLIARLE
NLHKLKRLEYLNVAINNIERVENLEGCESLSKLDLTLNFIRELTSVESLCGNYNLRELVL
IGNPCVDYPHYRDYVVATLPQLNSLDCVEITPSERLRALRELSKNRSIIVQKQVEQDIER
DEQRIRVAKQQSALAEHCAGIEDEEERIKAFWQAKSEHCPEIRTEIARQHRLGRERHETK
SPLDPLKPQRNLFAPCGRPYNLNQAKLPFKFRDEADHYLLQLEVYRHLDTSLIDVDVQTT
YTRVTVKKKIFQIAYSEEVKPDESTVQRSQITGHLVVNLKKLKVNELLIAKKSPTKSPAA
PFDAGKKDGKPEEAFHGGVVDISNICAPEDLPDLI
Download sequence
Identical sequences Q9VR52
7227.FBpp0077037 NP_608460.1.81976 FBpp0077037 FBpp0077037 FBpp0077037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]