SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0077073 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0077073
Domain Number 1 Region: 235-306
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000000977
Family Canonical RBD 0.046
Further Details:      
 
Domain Number 2 Region: 165-192
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000955
Family CCCH zinc finger 0.0056
Further Details:      
 
Weak hits

Sequence:  FBpp0077073
Domain Number - Region: 305-332
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0157
Family CCCH zinc finger 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0077073   Gene: FBgn0031628   Transcript: FBtr0077381
Sequence length 456
Comment pep:known chromosome:BDGP5:2L:4794658:4796581:1 gene:FBgn0031628 transcript:FBtr0077381 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGRKARRKLIKKQQRKRRRQKHAKERDKLEEEAENQRLMQPEYQKWSQEQEEMQEFQRL
ADERERQLAEESWLRREATAQRQFQMDEAKKRQEQEEVERLQREQAKERAEREERQRKQR
EEETRKAAKAAAEFDAMMESMDEYLNNPRIEKPPSHLLRVMETHPEERACEFFSRTNCCR
YGHACTFNHRRPMLGRILLIRHFFNHSMLQKRCTHKEYASAEEHLELTEQDLRHDYDEFF
NDVVEELRKFGTIVNFRTVRNTLEHLRGHVFVEYTNERSALRAFTNLQGRYYASKRLNVE
FSNLRTWRGAVCGLSLTRKCPKGNDCGYLHLFGNPNNLFNTELEYTSGPRSERRSSQTPT
AKTPSWDEHSEHGRNWRWSASPEVELENSKDLGNRGRDLKNNQQRNHHSRSRSDRSSVRS
KREHSSSGSSHDDRRSKRHHHHHNSTTPDHQHNHCQ
Download sequence
Identical sequences Q9VR26
NP_608857.2.81976 FBpp0077073 FBpp0077073 7227.FBpp0077073 FBpp0077074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]