SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0077082 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0077082
Domain Number 1 Region: 75-142
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000000513
Family SAM (sterile alpha motif) domain 0.061
Further Details:      
 
Weak hits

Sequence:  FBpp0077082
Domain Number - Region: 149-218
Classification Level Classification E-value
Superfamily Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.000471
Family Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0077082   Gene: FBgn0031644   Transcript: FBtr0077390
Sequence length 349
Comment pep:known chromosome:BDGP5:2L:4889995:4891378:1 gene:FBgn0031644 transcript:FBtr0077390 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPYLYGIADTKFLHQKVKKKTKIRSDMAPTKFQRNEFLKGCPKYDGDDIPIQFRTTPDSL
VELSIIVVDKLPLPSIFEWDDMDIRRWINGYGYPQYMNTFRVNMITGRKLLLLDASALCA
MNIKNFDHIRHISYGIRMLFHFELTKFSSSISLPDEKPNELYLLFHTQTGVNYDEVRRSD
LYRRMQMLRERARNLDHWDLLYLWLRHEQERKYKELIGMVPRFTMYKCEEAAKPPEEPED
MEPEELMCMTCIPPCDCDWTARDLRLPWRLECLPPMLETTMSKWNALQAQCSTCIPPCEC
RWPPRFYLTGTVIRCLQQRFPEKFCPIFDERYRASPRPSLVERWTRFSI
Download sequence
Identical sequences Q9VR43
NP_608872.1.81976 7227.FBpp0077082 FBpp0077082 FBpp0077082 FBpp0077082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]