SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0077109 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0077109
Domain Number 1 Region: 109-195
Classification Level Classification E-value
Superfamily Immunoglobulin 3.76e-18
Family I set domains 0.01
Further Details:      
 
Domain Number 2 Region: 214-313
Classification Level Classification E-value
Superfamily Immunoglobulin 3.28e-16
Family I set domains 0.026
Further Details:      
 
Domain Number 3 Region: 303-420
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000195
Family Fibronectin type III 0.0042
Further Details:      
 
Domain Number 4 Region: 33-116
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000868
Family I set domains 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0077109   Gene: FBgn0031627   Transcript: FBtr0077418
Sequence length 450
Comment pep:known chromosome:BDGP5:2L:4734592:4794040:-1 gene:FBgn0031627 transcript:FBtr0077418 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLIGFILNLAALTAVAWANHHESLSLSPAEHSVVRYTNESLIVQCRSPDPKVELHWKSP
KGEIIREHKGRIHIEQTSTEQLKIVFAHIALADKGNWSCEAADGSLHSKSFDLIVYQKIT
FTENATVMTVKEGEKATILCEVKGEPQPNVTWHFNGQPISAGAADDSKFRILADGLLINK
VTQNDTGEYACRAYQVNSIASDMQERTVLMKIEHKPIWSKTPFVSLKYAYINGTATLMCE
ALAEPPANFTWYRKHNKLHSNNRLYTIQSDSYWSSLTIHVLNTSAFDNYRCRARNDLGTI
ERTTRLEQGEKPPSPANFQLRGFNSNTFDVVLSAPRGPPDSPMGVNGFRIEYMTEMEFKT
DAGKWTNARRKDYAFEEGATFLLTNLEPDTVYLVRAASRNLAGFSDFTKVEKYKTLSLEP
RVSSGVKETRNMCVELGVMTLMVLMRPFLG
Download sequence
Identical sequences Q9VR25
FBpp0077109 NP_787975.1.81976 FBpp0077109 FBpp0077109 7227.FBpp0077109

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]