SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0077119 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0077119
Domain Number 1 Region: 329-479
Classification Level Classification E-value
Superfamily TRAF domain-like 5.23e-41
Family MATH domain 0.000018
Further Details:      
 
Domain Number 2 Region: 103-167
Classification Level Classification E-value
Superfamily TRAF domain-like 0.000000000258
Family SIAH, seven in absentia homolog 0.038
Further Details:      
 
Domain Number 3 Region: 253-296
Classification Level Classification E-value
Superfamily TRAF domain-like 0.000000719
Family SIAH, seven in absentia homolog 0.011
Further Details:      
 
Domain Number 4 Region: 217-268
Classification Level Classification E-value
Superfamily TRAF domain-like 0.00000915
Family SIAH, seven in absentia homolog 0.019
Further Details:      
 
Weak hits

Sequence:  FBpp0077119
Domain Number - Region: 163-216
Classification Level Classification E-value
Superfamily TRAF domain-like 0.00262
Family SIAH, seven in absentia homolog 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0077119   Gene: FBgn0026319   Transcript: FBtr0077429
Sequence length 486
Comment pep:known chromosome:BDGP5:2L:4371990:4380725:1 gene:FBgn0026319 transcript:FBtr0077429 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVRSLAQWTKTLSFPSRLSPNRNSKDCSTLASPVPPPTPPRNKTTSGSGNCATSRSSSST
VSSSHSSSHSSPTPGNNNNNMPITELEQIIYPGPDPKHIMGSLVFCIHHKQGCKWSDELR
KLKGHLNACKHDATQCPNKCGAQIPRIMMTDHLQYTCTMRRTRCEFCQSEFSGAGLEEHN
GSCGQEPVYCEAKCGQRILRGRMTLHKSKDCAKRLRRCAHCQREFSADTLPLHAAQCPRA
PLACPQRCDAGPIPRGELEAHLRDECQSLAVSCSFKEAGCRFKGPRQMLEAHLESNAAAH
LSLMVALSSRQGQQIQMLKSAVSKLSINYTGTLLWKITDWSAKMAEARGKDGLELVSPPF
YTSQYGYKLQASMFLNGNGPGENTHVSVYIKVLPGEYDALLKWPFSHSITFTLFEQGAQS
GQGGVAESFVPDPTWENFQRPSNEPDQLGFGFPRFISHELLHSRPFIKGDTVFLRVKVDP
SKIVAV
Download sequence
Identical sequences A0A0J9QWH8 Q9XYR0
FBpp0077119 NP_477416.1.81976 XP_016023411.1.80810 FBpp0077119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]