SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0077156 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0077156
Domain Number 1 Region: 132-308
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.16e-31
Family MAM domain 0.0034
Further Details:      
 
Domain Number 2 Region: 22-86
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000131
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 3 Region: 70-126
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000278
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 4 Region: 336-386
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000602
Family Somatomedin B domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0077156   Gene: FBgn0014033   Transcript: FBtr0077467
Sequence length 629
Comment pep:known chromosome:BDGP5:2L:4121721:4124002:1 gene:FBgn0014033 transcript:FBtr0077467 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFFWTLAVIVIYCIGHIHGRCERSIDLDNGSINYRQRNVVRFRCNRGYTLQGTVMQTCD
RDGRLRGEKPFCASRGCARPEDPENGHVENLSLRADVVCHDGYVLVGGRTAYCDGERWST
QLGSCRRSNHTRDHSCDFESEDQCGWEAETTFRRPWKRVSTVSDIHSLRTGPRHDHTFKN
ESGGHYMRMETQMGAYGSYHLLSPIYPRSLTLKTACCFRFHYFMFGAGVDNLVVSVKPVS
MPMATMWNRFRANCSKFEISGQQGTQWLEHTISIDEMQEDFQVIFTATDARSQFGDIAID
DVKLMTGSECGTNGFSTTTEPTAPTGSNEQPLVYDMMSCSGRCGTSISASNITNNGIVMG
CGCNDECLSDETCCLNYLEECTKELLTTTEDDISSLPPTVTSTSTSTTRKSTTTTTTSTT
TTSTTTTKRPTTTTTTTKATTTKRTTTTKKPTTTSTTPKPTTTTSTTPKSTTSTTSTTST
TPTTTTTINVFTTKKTTIMIPTSSTEKTTGINTTMKTRKRITWNVDPQDIEGHMDTSGST
PNPALVVLYLLLAIVLVVVLANVVNRWIIPITGSKTSSEKAVRFKKAFDSLKKQRKRNSM
DDQPLCDSDNDDVEYFEEMGVDIRHRTDL
Download sequence
Identical sequences Q9V3H7
FBpp0077156 FBpp0077156 FBpp0077156 7227.FBpp0077156 NP_001285599.1.81976 NP_477102.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]