SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0077158 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0077158
Domain Number 1 Region: 237-356
Classification Level Classification E-value
Superfamily C-type lectin-like 2.27e-29
Family C-type lectin domain 0.0011
Further Details:      
 
Weak hits

Sequence:  FBpp0077158
Domain Number - Region: 82-143
Classification Level Classification E-value
Superfamily Coiled-coil dimerization domain from cortexillin I 0.00994
Family Coiled-coil dimerization domain from cortexillin I 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0077158   Gene: FBgn0040102   Transcript: FBtr0077469
Sequence length 359
Comment pep:known chromosome:BDGP5:2L:4188123:4189285:1 gene:FBgn0040102 transcript:FBtr0077469 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRLEKCIVYLLVACNLVESRAESTENSRSVCLLKDPPNQCGEFCLSVLQPLLDHIVKHQ
EQWNTSEALWLNETQGKLDRIQTQLAAQALSLEESAQKVPGDIKDRLDRMEHLQTTLQES
LKKMPAELDARLMKMENQQKTLGDQLENQINLTKESQQDQLEALKNAMPINFEMRLAQIE
EQQKLLQETLKKIPEDFERKLQKLEQNQKDELTKLGAQQSANQVTLKEIYTKVFWPKFER
IGSRLFYINHKDAYDWQSAVDFCRDMGGYIAAIKDQEELDAISARLDDKSYWLGINDLQS
SNTYVSVASGREVEFLNWNAGEPNHGNEDENCVELIRSKMNDDPCHRKKHVICQTDKEV
Download sequence
Identical sequences Q9VQX3
FBpp0077158 FBpp0077158 FBpp0077158 NP_652641.1.81976 7227.FBpp0077158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]