SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0077338 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0077338
Domain Number 1 Region: 15-109
Classification Level Classification E-value
Superfamily UBC-like 0.000000000067
Family RWD domain 0.07
Further Details:      
 
Domain Number 2 Region: 233-293
Classification Level Classification E-value
Superfamily RING/U-box 0.00000118
Family RING finger domain, C3HC4 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0077338   Gene: FBgn0031498   Transcript: FBtr0077653
Sequence length 364
Comment pep:known chromosome:BDGP5:2L:3037411:3038793:1 gene:FBgn0031498 transcript:FBtr0077653 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFIDQEVTEFRAKCEKQVPHTKIIICSNSLIRVDIYPERPNRSMTMCLRFPENYPQSTQ
ILVELKSRVYSEMLLTELTRLIDDYARDFIGKPQALQVLAFAQQYLTDNPLCVCLEEIKQ
LRADIKTGGTESQLKLKQKNKSVELVAKGGRYTYRVIAVVPDSYPMQSVELRGQDSNLPA
VLVRYLNGQSKEIARQCVEPPIRMSKEALANFRPVRSLQRSLKFCLEATRDFHTERCPIC
DSTVLPEYPEDIETDDNADFFIERVYCGHLFHQGCLKKYLSEPPFPKGGKLCPAARRHPR
SDAQTYMGRSQGGGATVSKTPEDTVCGIKLAHDRWVVSVKTAEARWAQKQARQRELEEVV
DFLQ
Download sequence
Identical sequences Q9VQL2
FBpp0077338 NP_001259983.1.81976 NP_001285575.1.81976 NP_608744.1.81976 FBpp0077338 7227.FBpp0077338 FBpp0077338

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]