SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0077522 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0077522
Domain Number 1 Region: 394-539
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.63e-43
Family ets domain 0.00018
Further Details:      
 
Domain Number 2 Region: 20-114
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.74e-24
Family Pointed domain 0.0000274
Further Details:      
 
Weak hits

Sequence:  FBpp0077522
Domain Number - Region: 298-369
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.000251
Family beta-sandwich domain of Sec23/24 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0077522   Gene: FBgn0000097   Transcript: FBtr0077850
Sequence length 732
Comment pep:known chromosome:BDGP5:2L:2156484:2178749:-1 gene:FBgn0000097 transcript:FBtr0077850 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKMKMLPVQLSLNSLNPGIWSDVLWRCPPAPSSQLAELKTQLPPSLPSDPRLWSREDVL
VFLRFCVREFDLPKLDFDLFQMNGKALCLLTRADFGHRCPGAGDVLHNVLQMLIIESHMM
QWHLPNSPVTPTSRYPLSPHSHPPTPTWPPLNAPPENSPFHSSAHSLAGHHFMAPNSVTL
SPPPSVDSQASSPPQAPYQNGGATGAAPGSAGGSAPAAGGATNTSNPTSSSASSTGSNGS
QPNIMPMKGISSASSNHSDSEEEYSETSGGVSKMPPAPLSYSTASPPGTPILKDIKPNWT
QQLTNSFVNSWSQQQQQQQQQQAAAVAAVAAQAQQHQLQQQQQQQQLPQKLTLDNTAGPV
VTPAGGSISAPTTPSYMYKAKREFFPENSEPNTNGRLLWDFLQQLLNDRNQKYSDLIAWK
CRDTGVFKIVDPAGLAKLWGIQKNHLSMNYDKMSRALRYYYRVNILRKVQGERHCYQFLR
NPTELKNIKNISLLRQSTPANGNGGSPSMPQGSSQAPGSPAGQNWNPQQQSQQQQQSPQR
PASRNGPMSLPAVAAVAAAAAAAYGPPPTSPLFMHAINGAFHYLSAAAAGPPPNSPALNT
PSAVGGPDKFQFHPLKLENGSGSGSESAGEDLKPTDLSVSSKSTATSNEDCYPLIRNADG
LTTIKLIRYNEHQVAASPAGQSPKHDDQQAGASNASSSPRPMDQASEQAQPVPMESDCNG
GESEDSFRHMQQ
Download sequence
Identical sequences M9PC88 Q01842
FBpp0077522 FBpp0077523 FBpp0077522 FBpp0077523 FBpp0303508 FBpp0303509 FBpp0303510 NP_001259908.1.81976 NP_001259909.1.81976 NP_001259910.1.81976 NP_523455.2.81976 NP_722766.1.81976 FBpp0077522 7227.FBpp0077522

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]