SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0077630 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0077630
Domain Number 1 Region: 4-61
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000982
Family HkH motif-containing C2H2 finger 0.016
Further Details:      
 
Weak hits

Sequence:  FBpp0077630
Domain Number - Region: 54-79
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00432
Family CCCH zinc finger 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0077630   Gene: FBgn0051922   Transcript: FBtr0077965
Sequence length 139
Comment pep:known chromosome:BDGP5:2L:1170181:1170789:1 gene:FBgn0051922 transcript:FBtr0077965 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGKSYYCDYCCCFLKNDLNVRKLHNGGIAHAIAKSNYLKRYEDPKKILTEERQKTPCKR
YFGSYCKFETYCKFTHYSGDNLRELEKLVLARKKRKSRKKTNKCKRWPWKTHLRKGLPPS
LQPINPEKLKQTDFELSWG
Download sequence
Identical sequences Q8IPW7
NP_722687.1.81976 7227.FBpp0077630 FBpp0077630 FBpp0077630 FBpp0077630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]