SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0077687 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0077687
Domain Number 1 Region: 60-146
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.000000000144
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0092
Further Details:      
 
Domain Number 2 Region: 1108-1130
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000958
Family CCCH zinc finger 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0077687   Gene: FBgn0053526   Transcript: FBtr0091489
Sequence length 1135
Comment pep:known chromosome:BDGP5:2L:870465:877038:1 gene:FBgn0053526 transcript:FBtr0091489 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRIVPLQLLRCLRVLLDNNGGILSAVEVKRISGLMAKYSKKLVSKCVYVQILKSTKTEL
LGDFMAVGGWSLVYTWLNDAIRAMNWPLVQEILELLLLSPVDVNRLKINSAPILVKGLCK
DGGNEGVRILAKRLVEQWLKIVTENTSMTIQGAAPHIAATTASQVPASVSGAGSASVPDS
ASSSDSTDSAGAPVTYTITSAANSSNSNSITIKWKPLLDNPDGGDETDSGTQSKDNEVEH
LEKGSSATHLLADASLGKKSGLDDSSSAAEVKSGEDVDNKKHKSSKSDKSKRSEKEREKD
RKKESSSHRSSSSSHKSSSSSSSSSSKSSSSKSSSSSSSSHRSSSDKYRDKDKARSSSGS
SSSSKDRERSSGSSSSSSNKHKSSKSSSSSSSSSSSSSGSSSSKDRKSSSSTSSSSSSSR
QDKDKDNKLMPPPAVAASNAAGTSPTASAKESDAQKPRSIPIMSRKASISIEIRRDTEKT
ATVKTYQSKFRSHGLTEEAPPPPSRKGLKKPTSSAVAASPALMAVPSSLKRPSPPPRDLS
TDKKAKIDINNVAGHVERPGAAKLIAPKKIQTLVETNLFSDALAASIEPKKVVKRKRTSA
TSPTDKDAPLAPLKFYQDTLDESKSEEKSDDSSKENDDARSSSPGKDTDADDDDIPLKRV
KEDIEQKVQKAKAAAGGEGGEAGNTSDNAEDLPEEPKKPGPGCGPDGPPGVLTLHRRKGP
KKKLTWQSEEKLTQIRYFEVDRSERVNVMKQTFLEMKNMERFSERDALTIARRGFDDTME
PQMEWRPLLEVDNVPDHPNGNLSKQRQVQMDREATTLRALYFSPDMIPDSPAEAELEPHF
AHDIPVIPMDDLTGNPDAVNDYSALAWPEPKKYAPSSGVGANISGSDMGFNDNMLTGLGA
GPNLMQNPFDPFMGGMPAPTGMPPGPNMMPNQVPNGTPQIWQNQMGPVGGPPGVPPMMNG
PGGPGMDMSNMNMNNMPPQNFMGNQFGSPVSPFGSGPPPGFNQYPPMMMNGPGPGPVMGP
NGPVMGPNGPMMNGPPNGPMMNGPPNGMGPGLMMGGPRNNNNNNNRNKNNGGGIWRSGGN
NFQENSGGNWRSAGSGPNRGGGGGNGNTGVCKQFMRGHCNMGKNCKYVHPQKKRL
Download sequence
Identical sequences Q7KU01
FBpp0077684 NP_001014453.1.81976 NP_001259850.1.81976 FBpp0077687 FBpp0304322 FBpp0077687 7227.FBpp0077687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]