SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0077694 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0077694
Domain Number 1 Region: 121-225
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 6.69e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0077694   Gene: FBgn0020305   Transcript: FBtr0078030
Sequence length 345
Comment pep:known chromosome:BDGP5:2L:868673:869857:-1 gene:FBgn0020305 transcript:FBtr0078030 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSESEAEETKISTEPVDNAWSMKIPAFRQEDNPHGMVEESSFATLFPKYRERYLKEVWPL
VEQCLAEHHLKAELDLMEGSMVVKTSRKTWDPYIIIKARDMIKLMARSVPFEQAKRVLQD
DIGCDIIKIGNLVHKKEKFVKRRQRLIGPNGATLKSIELLTDCYVLVQGNTVSALGPYKG
LQQVRDIVLETMNNVHPIYNIKALMIKRELMKDPRLANEDWSRFLPKFKNKNISKRKQPK
VKKQKKEYTPFPPSQPESKVDKQLASGEYFLNQEQKQAKRNQERTEKQKEAAKRQDERRN
KDFVPPTEESAASSRKKEDGSSSSKVDVKALKAKLIKANKKARSS
Download sequence
Identical sequences Q9VPU8
FBpp0077694 FBpp0077694 NP_477240.1.81976 7227.FBpp0077694 FBpp0077694 7296147___KOG2874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]