SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0077739 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0077739
Domain Number 1 Region: 253-388
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.45e-48
Family ets domain 0.00000761
Further Details:      
 
Domain Number 2 Region: 122-213
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.41e-18
Family Pointed domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0077739   Gene: FBgn0005660   Transcript: FBtr0078079
Sequence length 475
Comment pep:known chromosome:BDGP5:2L:547016:552454:-1 gene:FBgn0005660 transcript:FBtr0078079 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAILQNSRQSHKQLPIISQTIRSAWCQQRPINAMHQDVRQKSIGSGNETKLEAKETEVPT
NRRRRRRRCSSSSTSDSSASSYSSTDSDSGSSTSSSSIRSQLPALNLPVPLPLATPTPPA
VSSPHQAPSPRRNSSDSNRSVSPVEVPVDPHAWTPEDIASWVRWATRKFKLDPEPDIDRF
PKDAQELCDLSRADFWVCAGSRRGGMLLAQHFAISLYHATGRETSPMLNDDEPNPYQLLN
AASHRLVAQGSGGQIQLWQFLLELLADSSNANAISWEGQSGEFRLIDPDEVARRWGERKA
KPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGLMAACQAQAQGGDPASSMLGSY
NHHAGGAMQLGRHPPPLHHHPQHSHPHHQLGQPHFLHPHHSSPASNSSSLGFPSSSTASS
QASPGQAPASSSASTSNFTAPFQGGTAGVDPARTSTSSAGNYDQGPVTPTTNAFN
Download sequence
Identical sequences A8E758 P29776
FBpp0077739 7227.FBpp0077739 FBpp0077739 NP_001285547.1.81976 NP_001285548.1.81976 NP_523445.1.81976 FBpp0077739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]