SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0077804 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0077804
Domain Number 1 Region: 1197-1253
Classification Level Classification E-value
Superfamily BRK domain-like 5.89e-18
Family BRK domain-like 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0077804   Gene: FBgn0086902   Transcript: FBtr0078145
Sequence length 2151
Comment pep:known chromosome:BDGP5:2L:210735:221962:-1 gene:FBgn0086902 transcript:FBtr0078145 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVIKPMDFSSFSAFCEHLNKSSQIAATTATTIPPTINNGKGIYLEKMERQGKMELAAKE
RESQRLQLIPKKWNRREEYEFLRVLTGYGVDLHVSTPMASSNGSSLSPDWTKFKQMAHLE
RKSDETLTDYYKVFVAMCKRQAGLKLSESERGLEGIIEEIEKEHAKLILDRLEVLAKLRE
VARNPMLEERLKLCTKNADTPDWWEPGRHDKELITAVLKHGLYRSETFIFNDPNFSFGES
EKRFIRELEAQIQRTIKLEAFNAEKAEKLAAAEKDAATEKAAATEKAAAEKAASVKNEVI
DLDDELMTNESVIKKESPVTPIKEEIKSEESPEKHDTADNLEDKNSDAEESTKIKGKEDF
NPETTEKEALDESTNLNKDKSSTETLVPEIEDSKPSEDKMEVEELPVAENGEKEGSPEKC
SDAEDKKFSEEKPSSPAVPDGKVSEMEADEAAPNTEENCSGDSESPEKECEDKVVEKVEE
EKGENSYEKAEEQKEETEKLEKSSIESEPSEKSETVLEPEVAVPKKSTGDQDILDLVAGP
SDPDDDEVMKEKEKAVEEECKKQAAELKARFPDLEVIQPATVKQQKLEKPKLEMCMIRWF
KDFALERRIAHIVACVESGNWPVDSKYSAFATCKGATDLSIALHESIPHLSSLERRSTTP
DVITITTDQGVTKHLQTSHMQQVASSASAASTSSGVPQVTQSKPSSSNSLPGLDAKSINA
AVAAAVAAAAAGGNATSLSSLLPGMSLSAATGSSAGGVSGLSVPSAGSGVGKKRKRHIAI
DVETERAKLHALLNSSTMAPKDWESEIANMEALSGSSGRGRGGNSSASSGMQPPPAHQHA
SLSRQSSGQFSKPAVPAMKTPPPSMGAPMDLSSSLPKMNMTEMLKSASSSGAIDLSEVQD
FSMPSKKSSVHAALSSAFPSMGNKSKLDDTLNKLMKKNNCTIEEPVIGKEKKRKKLDEIV
LGLSAAKEQKTFPDPSLPSSKKPQIPPSVSVTPANLQSSSNQQSNQKPFTITVTTVPGKS
KSGSSNSGSGTGGSSSASGGGAGGSGLSALQNMAMGGLSSKDSLNALLAQTMATDPQTFL
KQQQKMMQFLPPAQRKAYENMLAEMEQAMKISSKFSTNSPHDVKVNKWLSDMTSPLGDQL
SIDYVGGGGASGSGSGNSRRSNRQQGNSQQSSSAAQLQKQQQQQQQQQQQQQQHSMPGPQ
NLTGEEPVPVINKQTGKRLGGNKAPQLKRLMQWLTENPNYEVDPKWLEQMQNPMSTPSPR
PASMESGYGSSAVKSHGGRPLSNLSSTSSSSHTQQQSSAAQSQAGGNSGSSKKNSRQQTA
ASAALDQAALQFGSLAGLNPSLLANLPGLGAFDPKNPLAAFDPKNPLLSMSFGGMPGMGN
IPGLGNLNNMNLFASLAGMGGLGNLAGMDTQSLAALMAAAGPTLGGLTGASGGAGSGKSQ
AQSQSSATSSSSSASKKKQQQQQQQAQNEAAQLAAAISASTGGSGASGGKNAAASASQLA
AGFPFLFPNPSLLYPPMGLGGLNPYSLGSSGLGSAYDQLAQQYNLLNGATSSASNTSSTQ
SKSHQSQSKSSQSRNTTASANSAASLMNAMASMGGGASTVTTPSTSASGSGRGRQSSSRN
QSQTTPTAADMAQLSSLLMPGADPHLLESLSRMSNMDLAQATRLMSSLGMPPLSGTPSSS
GGGNTSTSKRSSQAANEANVQAKEQQKWLESLARGALPTDLAALQAFSQGKMPSTSGSNT
GTSTSSSKSSKAAATAAAAQLPQIPGMSSDFPQAFLAEMAAQAMAAAGGSLPLSGPGSLA
SLAGLTGGSAGGGGSSASGSTSHSSSKRQREQDAFKQQMDYYTKTLGLGSGISLIPTSSA
GGSSASSSAANAAAAAYAAALDAEQQHQQQQKALSKRARGDLHPTKEELAALAAGLPLNL
GASMSSIEKSLRGGSSSSSSSTPAPMTAEQDKVTLTPLNASGGGSGSSSSSAAAAGLAAN
LPSQTTITIAPPISSGASTSSERSERSESRISLTITNAADAAKLPPPYEEADELIIQPIL
KKPTAANPGSSHGGSVDDLDTAENTSAANLSGSSSSSAAAAAAAAAEENRRSSNRLKRPR
SGNEQGSGSVEGQPPEKRRELRSTRHTRSSADASTLNLSTGSESGAEERNE
Download sequence
Identical sequences Q9VPL6
FBpp0077804 FBpp0077804 NP_722617.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]