SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0077950 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0077950
Domain Number 1 Region: 29-229
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.35e-59
Family Arfaptin, Rac-binding fragment 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0077950   Gene: FBgn0037050   Transcript: FBtr0078292
Sequence length 411
Comment pep:known chromosome:BDGP5:3L:21124546:21126410:1 gene:FBgn0037050 transcript:FBtr0078292 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKSEVQHQFWITKKVVQRKLGTKEDKHIISSDAELDSKIEVFKSISDTSLNLCKIIDQY
QERLCILSQEECVFGRFLKEAGKRSRTTGGSIAHTAKAVSFAGQQRMCVRVPLLRLQHEV
DVFRCRAIKDTEQTLQTMEKERTEYRAALSWMKSASQELDPDTGKGLDKFRTAQAHVRVA
KHNFDGYSMDSIQKIDLLAAARCNMYSHALVAYVTELKNFAQKAASTFQTISKALIIKPK
YDFCVLKELSQNEGSTEEVPPIEAVDKDQSLFFANEYQDKLETQPEIKESEEDKPSAPPN
ACGDNESLLIELSKQLEDSPLIDAPLDEDIPAQNSTNKLWSRLFSQQNQQPIPSQVATDS
KASAGGATPVPSKSQTTNNPWLDLFADLDPLANPQAFDLKLSGGRSVAEQT
Download sequence
Identical sequences Q9VP78
FBpp0077950 FBpp0293952 FBpp0077950 FBpp0077950 NP_001246855.1.81976 NP_649283.1.81976 7227.FBpp0077950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]