SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0077975 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0077975
Domain Number 1 Region: 25-100
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.53e-17
Family Ubiquitin-related 0.0014
Further Details:      
 
Domain Number 2 Region: 430-473
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000565
Family RING finger domain, C3HC4 0.0017
Further Details:      
 
Domain Number 3 Region: 341-391
Classification Level Classification E-value
Superfamily RING/U-box 0.000000459
Family RING finger domain, C3HC4 0.091
Further Details:      
 
Domain Number 4 Region: 257-344
Classification Level Classification E-value
Superfamily RING/U-box 0.0000895
Family RING finger domain, C3HC4 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0077975   Gene: FBgn0041100   Transcript: FBtr0078319
Sequence length 482
Comment pep:known chromosome:BDGP5:3L:21187854:21189869:-1 gene:FBgn0041100 transcript:FBtr0078319 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFIFKFIATFVRKMLELLQFGGKTLTHTLSIYVKTNTGKTLTVNLEPQWDIKNVKELVA
PQLGLQPDDLKIIFAGKELSDATTIEQCDLGQQSVLHAIRLRPPVQRQKIQSATLEEEEP
SLSDEASKPLNETLLDLQLESEERLNITDEERVRAKAHFFVHCSQCDKLCNGKLRVRCAL
CKGGAFTVHRDPECWDDVLKSRRIPGHCESLEVACVDNAAGDPPFAEFFFKCAEHVSGGE
KDFAAPLNLIKNNIKNVPCLACTDVSDTVLVFPCASQHVTCIDCFRHYCRSRLGERQFMP
HPDFGYTLPCPAGCEHSFIEEIHHFKLLTREEYDRYQRFATEEYVLQAGGVLCPQPGCGM
GLLVEPDCRKVTCQNGCGYVFCRNCLQGYHIGECLPEGTGASATNSCEYTVDPNRAAEAR
WDEASNVTIKVSTKPCPKCRTPTERDGGCMHMVCTRAGCGFEWCWVCQTEWTRDCMGAHW
FG
Download sequence
Identical sequences Q7KTX7
7227.FBpp0077975 FBpp0077974 FBpp0077974 FBpp0077975 NP_730600.1.81976 NP_730601.1.81976 FBpp0077974 FBpp0077975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]